All public logs
Jump to navigation
Jump to search
Combined display of all available logs of "A B C". You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).
(newest | oldest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)- 05:05, 17 October 2022 Boris talk contribs created page BCB420 2015 Project Plan (Created page with "<div class="b1"> The 2015 Computational Systems Biology Project </div> __TOC__ <section begin=abstract /> <div style="background-color:#FFFF99; font-size:110%; border:solid...")
- 01:37, 6 September 2021 Boris talk contribs moved page BIN-GENOME-NGS bioinformatics to BIN-GENOME-NGS Bioinformatics
- 01:37, 6 September 2021 Boris talk contribs moved page BIN-GENOME-Human genomics to BIN-GENOME-Human Genomics
- 01:33, 6 September 2021 Boris talk contribs moved page BIN-GENOME-Browsers to BIN-GENOME-Genome Browsers
- 01:28, 6 September 2021 Boris talk contribs moved page BIN-GENOME-Annotation to BIN-GENOME-Genome Annotation
- 01:07, 6 September 2021 Boris talk contribs moved page RPR-Objects-Lists to RPR-OBJECTS-Lists
- 01:06, 6 September 2021 Boris talk contribs moved page RPR-Objects-Data frames to RPR-OBJECTS-Data frames
- 01:06, 6 September 2021 Boris talk contribs moved page RPR-Objects-Vectors to RPR-OBJECTS-Vectors
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-Genome-NGS bioinformatics to BIN-GENOME-NGS bioinformatics
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-Genome-Human genomics to BIN-GENOME-Human genomics
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-Genome-Browsers to BIN-GENOME-Browsers
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-Genome-Annotation to BIN-GENOME-Annotation
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-Genome-Sequencing to BIN-GENOME-Genome Sequencing
- 01:06, 6 September 2021 Boris talk contribs moved page BIN-ALI-PSI-BLAST to BIN-ALI-PSI BLAST
- 21:31, 4 September 2021 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 12:45, 23 April 2021 Boris talk contribs moved page ABC-Plagiarism to ABC-Academic integrity (Refocus page contents)
- 21:57, 17 November 2020 Boris talk contribs created page User:Boris/tmp1 (Created page with " == Strategic Errors == * Not showing your data * Not understanding what data to show * '''Not properly citing''' * Hiding problems, rather than addressing them {{Vspace}}...")
- 08:49, 26 October 2020 Boris talk contribs created page MediaWiki:Gadget-ReferenceTooltips.css (Created page with "See mw:Reference Tooltips: .rt-tooltip { position: absolute; z-index: 100; max-width: 350px; background: #fff; color: #222; font-size: 13px; line-height: 1.5e...")
- 08:47, 26 October 2020 Boris talk contribs created page MediaWiki:Gadgets-definition (Created page with "* ReferenceTooltips[ResourceLoader|default|type=general|dependencies=mediawiki.cookie,jquery.client]|ReferenceTooltips.js|ReferenceTooltips.css")
- 08:46, 26 October 2020 Boris talk contribs created page MediaWiki:Gadget-ReferenceTooltips (Created page with "Reference Tooltips: hover over inline citations to see reference information without moving away from the article text (does not work if...")
- 08:45, 26 October 2020 Boris talk contribs created page MediaWiki:Gadget-ReferenceTooltips.js (Created page with "// See mw:Reference Tooltips // Source https://en.wikipedia.org/wiki/MediaWiki:Gadget-ReferenceTooltips.js ( function () { // enwiki settings var REF_LINK_SELECTOR = '.r...")
- 03:53, 11 October 2020 Boris talk contribs uploaded File:JS-2POR-2.jpg
- 03:53, 11 October 2020 Boris talk contribs created page File:JS-2POR-2.jpg
- 03:52, 11 October 2020 Boris talk contribs uploaded File:JS-2POR-1.jpg
- 03:52, 11 October 2020 Boris talk contribs created page File:JS-2POR-1.jpg
- 03:52, 11 October 2020 Boris talk contribs uploaded File:SY-SubtilisinTrypsin.jpg
- 03:52, 11 October 2020 Boris talk contribs created page File:SY-SubtilisinTrypsin.jpg
- 08:58, 10 October 2020 Boris talk contribs uploaded File:CH-Worm 1BM8.png
- 08:58, 10 October 2020 Boris talk contribs created page File:CH-Worm 1BM8.png
- 08:57, 10 October 2020 Boris talk contribs deleted page File:CH-Worm 1BM8.png
- 08:56, 10 October 2020 Boris talk contribs moved page File:CH-Worm 1BM8.jpg.png to File:CH-Worm 1BM8.png without leaving a redirect
- 08:54, 10 October 2020 Boris talk contribs uploaded File:CH-Worm 1BM8.jpg.png
- 08:54, 10 October 2020 Boris talk contribs created page File:CH-Worm 1BM8.jpg.png
- 07:19, 10 October 2020 Boris talk contribs created page Template:CC-BY-Small (Created page with "<small>([http://creativecommons.org/licenses/by/4.0/ CC BY])</small>")
- 05:26, 29 September 2020 Boris talk contribs created page Category:ABC-Integrator units (Created page with "Milestones and capstones")
- 05:04, 29 September 2020 Boris talk contribs created page BCH441 Oral Test instructions (Created page with "<div id="BIO"> <div class="b1"> Oral Test instructions </div> {{Smallvspace}} __TOC__ {{Vspace}} == Instructions == {{Smallvspace}} <div class="alert"> Coming soon. </div...")
- 05:03, 29 September 2020 Boris talk contribs created page BCH441 Code submisson instructions (Created page with "<div id="BIO"> <div class="b1"> Code submission instructions </div> {{Smallvspace}} __TOC__ {{Vspace}} == Instructions == {{Smallvspace}} <div class="alert"> Coming soon....")
- 09:07, 25 September 2020 Boris talk contribs created page Category:ABC Milestone Unit (Created page with "Milestones!")
- 05:34, 23 September 2020 Boris talk contribs created page Category:ABC-units for evaluation (Created page with "Pages for which material can be submitted for evaluation.")
- 05:33, 23 September 2020 Boris talk contribs created page Category:ABC-units - live (Created page with "Live pages.")
- 01:41, 23 September 2020 Boris talk contribs created page RPR-Data-Split (Created page with "<div id="ABC"> <div style="padding:5px; border:1px solid #000000; background-color:#f2fafa; font-size:300%; font-weight:400; color: #000000; width:100%;"> Split and Modify Dat...")
- 01:41, 23 September 2020 Boris talk contribs created page RPR-Data-Reshape (Created page with "<div id="ABC"> <div style="padding:5px; border:1px solid #000000; background-color:#f2fafa; font-size:300%; font-weight:400; color: #000000; width:100%;"> Reshaping Data <div...")
- 01:41, 23 September 2020 Boris talk contribs created page RPR-Data-Merge (Created page with "<div id="ABC"> <div style="padding:5px; border:1px solid #000000; background-color:#f2fafa; font-size:300%; font-weight:400; color: #000000; width:100%;"> Merging and Joining...")
- 00:07, 23 September 2020 Boris talk contribs created page Template:SLEEP (Created page with "<div class="reference-box"><small>This page is not currently being maintained since it is not part of active learning sections.</small> </div> <includeonly>Category:ABC-unit...")
- 00:02, 23 September 2020 Boris talk contribs created page Template:MILESTONE (Created page with "<includeonly>Category:ABC Milestone Unit</includeonly>")
- 00:01, 23 September 2020 Boris talk contribs created page Template:INTEGRATOR (Created page with "<includeonly>Category:ABC-Integrator units</includeonly>")
- 23:59, 22 September 2020 Boris talk contribs created page Template:UNIT (Created page with "<!-- Status: UNIT -->")
- 08:18, 22 September 2020 Boris talk contribs uploaded a new version of File:1BM8 basic stereo.jpg
- 03:56, 22 September 2020 Boris talk contribs created page Template:EVAL (Created page with "<includeonly>Category:ABC-units_for_evaluation</includeonly>")
- 14:28, 21 September 2020 Boris talk contribs created page Category:ABC-unit hold (Created page with "Release with priority.")
- 06:25, 21 September 2020 Boris talk contribs uploaded File:ProteinDBschema.svg
- 06:25, 21 September 2020 Boris talk contribs created page File:ProteinDBschema.svg
- 12:06, 18 September 2020 Boris talk contribs created page Template:HOLD (Created page with "<div class="alert"><small>Please hold!<br /> This page still needs to undergo revisions. Do not work on these tasks yet, and do not prepare contents for submission. </div> <in...")
- 09:19, 17 September 2020 Boris talk contribs created page Category:ABC-units to be revised (Created page with "Let's do this ...")
- 11:15, 8 September 2020 Boris talk contribs created page Category:Pages with syntax highlighting errors (Created page with "Syntax highlighting errors")
- 06:37, 1 September 2020 Boris talk contribs deleted page File:ABC-Units landscape.svg (Deleted old revision 20200901063701!ABC-Units_landscape.svg)
- 06:37, 1 September 2020 Boris talk contribs uploaded a new version of File:ABC-Units landscape.svg
- 06:36, 1 September 2020 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20200901063624!ABC-units_map.svg)
- 06:36, 1 September 2020 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 06:24, 1 September 2020 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171120184654!ABC-units_map.svg)
- 06:24, 1 September 2020 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20200901060921!ABC-units_map.svg)
- 06:24, 1 September 2020 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20200901062101!ABC-units_map.svg)
- 06:23, 1 September 2020 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20200901062322!ABC-units_map.svg)
- 06:23, 1 September 2020 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 06:21, 1 September 2020 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 06:13, 1 September 2020 Boris talk contribs uploaded File:ABC-Units landscape.svg
- 06:13, 1 September 2020 Boris talk contribs created page File:ABC-Units landscape.svg
- 06:13, 1 September 2020 Boris talk contribs deleted page File:ABC-Units landscape.jpg
- 06:09, 1 September 2020 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 02:03, 28 April 2019 Boris talk contribs uploaded File:PHALY sketch.2019.01.JPG
- 00:32, 5 March 2019 Boris talk contribs moved page Template:Dropdate to Template:DropdateSpring without leaving a redirect
- 00:32, 5 March 2019 Boris talk contribs moved page Template:Lastdate to Template:LastdateSpring without leaving a redirect
- 15:15, 5 November 2018 Boris talk contribs deleted page User:Boris/Temp
- 18:44, 3 November 2018 Boris talk contribs deleted page User:Boris/Temp
- 19:58, 18 September 2018 Boris talk contribs uploaded File:Zhang-2018-Figure 3B.jpg
- 20:12, 11 September 2018 Boris talk contribs uploaded File:ABC-Units landscape.jpg
- 00:53, 24 February 2018 Boris talk contribs moved page BIO project to BIO systems project without leaving a redirect
- 00:53, 24 February 2018 Boris talk contribs deleted page BIO Open project (content was: "#REDIRECT BIO project" (and the only contributor was "Boris"))
- 01:46, 7 February 2018 Boris talk contribs uploaded File:CeleraPosterChr4.med.jpg
- 01:45, 7 February 2018 Boris talk contribs uploaded File:CeleraPosterTop.med.jpg
- 01:44, 7 February 2018 Boris talk contribs deleted page File:CeleraPosterChr4.med.JPG
- 01:24, 7 February 2018 Boris talk contribs uploaded File:CeleraPosterChr4.med.JPG
- 01:23, 7 February 2018 Boris talk contribs uploaded File:CeleraPoster.med.jpg
- 00:10, 27 January 2018 Boris talk contribs uploaded a new version of File:BCB420-Units.svg
- 16:29, 9 January 2018 Boris talk contribs deleted page /ABC-Plagiarism (content was: "<div id="BIO"> <div class="b1"> Plagiarism and academic misconduct </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Plagiarism, proper citing..." (and the only contributor was "Boris"))
- 00:42, 9 January 2018 Boris talk contribs uploaded File:BCB420-Units.svg
- 18:47, 20 November 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171111041009!ABC-units_map.svg)
- 18:47, 20 November 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171031173501!ABC-units_map.svg)
- 18:46, 20 November 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 12:52, 15 November 2017 Boris talk contribs moved page BIN-SEQA-Constitution to BIN-SEQA-Composition without leaving a redirect
- 04:10, 11 November 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 04:06, 9 November 2017 Boris talk contribs uploaded File:Water canister.jpg
- 02:27, 9 November 2017 Boris talk contribs moved page BIN-SEQA-Cooperation to BIN-SEQA-Collaboration without leaving a redirect
- 02:14, 9 November 2017 Boris talk contribs moved page BIN-SEQA-Composition to BIN-SEQA-Constitution without leaving a redirect
- 21:08, 3 November 2017 Boris talk contribs moved page FND-STA-Multiple testing to BIN-EXPR-Multiple testing without leaving a redirect
- 17:35, 31 October 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171026154517!ABC-units_map.svg)
- 17:35, 31 October 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 17:00, 31 October 2017 Boris talk contribs moved page BIN-SX-Homology modeling to BIN-SX-Homology modelling without leaving a redirect
- 16:25, 31 October 2017 Boris talk contribs deleted page FND-EXPR-Measurements (obsolete)
- 16:25, 31 October 2017 Boris talk contribs deleted page BIN-Genome-Databases (obsolete)
- 14:54, 30 October 2017 Boris talk contribs deleted page BIN-SX-Stereo vision (obsolete)
- 14:41, 30 October 2017 Boris talk contribs deleted page BIN-SX-Prediction concepts (obsolete)
- 15:45, 26 October 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171015173445!ABC-units_map.svg)
- 15:45, 26 October 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 21:52, 16 October 2017 Boris talk contribs uploaded File:Ras Cycle.jpg
- 17:35, 15 October 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20171004040105!ABC-units_map.svg)
- 17:34, 15 October 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 17:11, 15 October 2017 Boris talk contribs moved page RPR-Testing to RPR-Unit testing without leaving a redirect
- 17:10, 15 October 2017 Boris talk contribs moved page FND-CSC-Unit testing to FND-CSC-Test driven development without leaving a redirect
- 16:25, 8 October 2017 Boris talk contribs deleted page Template:R-unit (Obsolete)
- 20:43, 5 October 2017 Boris talk contribs deleted page R Test Driven Development (content was: "<div id="APB"> <div class="b1"> Test Driven Development </div> <section begin=contents_summary /> This is an introduction to Test Driven Development (TDD) in '''R..." (and the only contributor was "Boris"))
- 10:50, 4 October 2017 Boris talk contribs deleted page File:BCB410-units.svg (Deleted old revision 20171004105009!BCB410-units.svg)
- 10:50, 4 October 2017 Boris talk contribs uploaded a new version of File:BCB410-units.svg
- 04:01, 4 October 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170930133816!ABC-units_map.svg)
- 04:01, 4 October 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170929161610!ABC-units_map.svg)
- 04:01, 4 October 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 02:51, 4 October 2017 Boris talk contribs moved page BIN-YFO to BIN-MYSPE without leaving a redirect
- 13:38, 30 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 16:16, 29 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170926192026!ABC-units_map.svg)
- 16:16, 29 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 19:20, 26 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170925104836!ABC-units_map.svg)
- 19:20, 26 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 10:48, 25 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 14:44, 19 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170919144350!ABC-units_map.svg)
- 14:44, 19 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170912195838!ABC-units_map.svg)
- 14:44, 19 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170905015634!ABC-units_map.svg)
- 14:44, 19 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170831042326!ABC-units_map.svg)
- 14:44, 19 September 2017 Boris talk contribs deleted page File:ABC-units map.svg (Deleted old revision 20170830222404!ABC-units_map.svg)
- 14:43, 19 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 14:25, 19 September 2017 Boris talk contribs moved page FND-EDA-Hypothesis testing to FND-STA-Hypothesis testing without leaving a redirect
- 13:56, 19 September 2017 Boris talk contribs deleted page FND-EDA-Data import (content was: "<div id="BIO"> <div class="b1"> Data Import </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Automating queries, Importing data, Integrating ..." (and the only contributor was "Boris"))
- 13:55, 19 September 2017 Boris talk contribs deleted page FND-EDA-Concepts (content was: "<div id="BIO"> <div class="b1"> Concepts of Exploratory Data Analysis </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Concepts of Explorator..." (and the only contributor was "Boris"))
- 13:53, 19 September 2017 Boris talk contribs deleted page FND-EDA-Dimension reduction (content was: "<div id="BIO"> <div class="b1"> Dimension Reduction </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> PCA and model-based correlations </div> ..." (and the only contributor was "Boris"))
- 13:52, 19 September 2017 Boris talk contribs deleted page FND-EDA-Regression (content was: "<div id="BIO"> <div class="b1"> Regression Analysis </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Linear and non-linear regression </div> ..." (and the only contributor was "Boris"))
- 13:49, 19 September 2017 Boris talk contribs deleted page FND-EDA-Machine learning (content was: "<div id="BIO"> <div class="b1"> Introduction to Machine Learning </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Principles of machine learn..." (and the only contributor was "Boris"))
- 13:49, 19 September 2017 Boris talk contribs deleted page FND-EDA-Clustering (content was: "<div id="BIO"> <div class="b1"> Clustering in Exploratory Data Analysis </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Clustering: hierarch..." (and the only contributor was "Boris"))
- 01:17, 19 September 2017 Boris talk contribs uploaded File:BCB410-units.svg
- 20:12, 18 September 2017 Boris talk contribs deleted page APB-ML-mlr (content was: "<div id="BIO"> <div class="b1"> The mlr R Package </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ ..." (and the only contributor was "Boris"))
- 20:10, 18 September 2017 Boris talk contribs deleted page APB-Data-Correlation (content was: "<div id="BIO"> <div class="b1"> Correlation </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Correlation: measurement, significance, Pearson...." (and the only contributor was "Boris"))
- 20:10, 18 September 2017 Boris talk contribs deleted page APB-ML-Deep neural networks (content was: "<div id="BIO"> <div class="b1"> Deep Neural Networks </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) Principles; applications; good ..." (and the only contributor was "Boris"))
- 20:10, 18 September 2017 Boris talk contribs deleted page APB-ML-Features (content was: "<div id="BIO"> <div class="b1"> Features for Machine Leraning </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}}..." (and the only contributor was "Boris"))
- 20:10, 18 September 2017 Boris talk contribs deleted page APB-ML-Feature importance (content was: "<div id="BIO"> <div class="b1"> Assessing Feature Importance </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} ..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page APB-ML-h2o (content was: "<div id="BIO"> <div class="b1"> The h2o Machine Learning Toolkit </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspac..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page APB-ML-Random forests (content was: "<div id="BIO"> <div class="b1"> Random Forests </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ {{V..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page APB-ML-Measuring performance (content was: "<div id="BIO"> <div class="b1"> Quantifying Machine Leraning Performance </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> ..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page APB-ML-Support Vector Machines (content was: "<div id="BIO"> <div class="b1"> SVM (Support Vector Machines) </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}}..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page APB-ML-RWeka (content was: "<div id="BIO"> <div class="b1"> The Weka Machine Learning Toolkit </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspa..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Centroid based (content was: "<div id="BIO"> <div class="b1"> Centroid Based Clustering </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} _..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Density based (content was: "<div id="BIO"> <div class="b1"> Density Based Clustering </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Mutual information (content was: "<div id="BIO"> <div class="b1"> Clustering by Mutual Information </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspac..." (and the only contributor was "Boris"))
- 20:09, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Hierarchical (content was: "<div id="BIO"> <div class="b1"> Hierarchical Clustering </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __T..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Distribution based (content was: "<div id="BIO"> <div class="b1"> Distribution Based Clustering </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}}..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-CLU-Quality (content was: "<div id="BIO"> <div class="b1"> Assessing Cluster Quality </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} _..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-DR-Embedding (content was: "<div id="BIO"> <div class="b1"> Dimension Reduction by Embedding </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspac..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-DR-Model based (content was: "<div id="BIO"> <div class="b1"> Model-based Dimension Reduction </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-DR-MDS (content was: "<div id="BIO"> <div class="b1"> Dimension Reduction by Multidimensional Scaling </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... ..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-DR-PCA (content was: "<div id="BIO"> <div class="b1"> PCA (Principal Components Analysis) </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vs..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-Heatmap (content was: "<div id="BIO"> <div class="b1"> Heatmaps </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ {{Vspace}..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-Graph data mining (content was: "<div id="BIO"> <div class="b1"> Graph Data Mining </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ ..." (and the only contributor was "Boris"))
- 20:08, 18 September 2017 Boris talk contribs deleted page EDA-MOD-Assessment (content was: "<div id="BIO"> <div class="b1"> Assessment of Statistical Models </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspac..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page EDA-MOD-Logistic (content was: "<div id="BIO"> <div class="b1"> Logistic Regression </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page EDA-MOD-Linear (content was: "<div id="BIO"> <div class="b1"> Linear Regression </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ ..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page EDA-MOD-Generalized (content was: "<div id="BIO"> <div class="b1"> Generalized Linear Models </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} _..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page EDA-MOD-Nonlinear (content was: "<div id="BIO"> <div class="b1"> Nonlinear regression </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC_..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page EDA-Visualization (content was: "<div id="BIO"> <div class="b1"> Visualization for EDA </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page RPR-Data-Merge (content was: "<div id="BIO"> <div class="b1"> Merging and Joining Data </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) </div> {{Vspace}} __TOC..." (and the only contributor was "Boris"))
- 20:07, 18 September 2017 Boris talk contribs deleted page RPR-Data-Imputation (content was: "<div id="BIO"> <div class="b1"> Imputation </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) ... </div> {{Vspace}} __TOC__ {{Vspac..." (and the only contributor was "Boris"))
- 20:06, 18 September 2017 Boris talk contribs deleted page RPR-Data-Reshape (content was: "<div id="BIO"> <div class="b1"> Reshaping Data </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) </div> {{Vspace}} __TOC__ {{Vspa..." (and the only contributor was "Boris"))
- 20:06, 18 September 2017 Boris talk contribs deleted page RPR-Factors (content was: "<div id="BIO"> <div class="b1"> R's Factors </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) </div> {{Vspace}} __TOC__ {{Vspace}..." (and the only contributor was "Boris"))
- 20:06, 18 September 2017 Boris talk contribs deleted page RPR-Data-Split (content was: "<div id="BIO"> <div class="b1"> Split and Modify Data </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) </div> {{Vspace}} __TOC__ ..." (and the only contributor was "Boris"))
- 20:06, 18 September 2017 Boris talk contribs deleted page RPR-Literate programming (content was: "<div id="BIO"> <div class="b1"> Literate Programming with R </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> (Draft) Literate programming pri..." (and the only contributor was "Boris"))
- 19:58, 12 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 15:54, 12 September 2017 Boris talk contribs deleted page RPR-Scope (content was: "<div id="BIO"> <div class="b1"> "Scope" in R </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> What is “scope”? The R workspace, global an..." (and the only contributor was "Boris"))
- 17:51, 10 September 2017 Boris talk contribs moved page RPR-Objects-Dataframes to RPR-Objects-Data frames without leaving a redirect
- 19:43, 7 September 2017 Boris talk contribs deleted page FND-Computer literacy (content was: "<div id="BIO"> <div class="b1"> Computer Literacy for Biocomputing </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Paths, folders and files ..." (and the only contributor was "Boris"))
- 17:29, 7 September 2017 Boris talk contribs deleted page FND-Communicating (content was: "<div id="BIO"> <div class="b1"> Communication Tools </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Mailing list vs. forum, alternatives </d..." (and the only contributor was "Boris"))
- 17:28, 7 September 2017 Boris talk contribs deleted page FND-Collaborating (content was: "<div id="BIO"> <div class="b1"> Collaboration Tools </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Wikis, Google docs, Slack </div> {{Vspa..." (and the only contributor was "Boris"))
- 14:34, 7 September 2017 Boris talk contribs deleted page BCB410 2015 (Obsolete - see BCB410 instead)
- 14:31, 7 September 2017 Boris talk contribs deleted page BCB410 2012 (content was: "#REDIRECT BCB410" (and the only contributor was "Boris"))
- 01:56, 5 September 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 01:41, 5 September 2017 Boris talk contribs uploaded File:ABC-units map themes.jpg
- 13:57, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-final.jpg
- 13:57, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-8.jpg
- 13:57, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-7.jpg
- 13:56, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-6.jpg
- 13:56, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-5.jpg
- 13:56, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-4.jpg
- 13:56, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-3.jpg
- 13:55, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-2.jpg
- 13:55, 4 September 2017 Boris talk contribs uploaded File:ABC-Scenario-1-Step-1.jpg
- 17:03, 3 September 2017 Boris talk contribs moved page FND-CSC-Software engineering to FND-CSC-Software development without leaving a redirect
- 22:37, 1 September 2017 Boris talk contribs deleted page Grading (superseded by ABC-Rubrics)
- 16:07, 31 August 2017 Boris talk contribs deleted page Misconduct (content was: "<div id="BIO"> <div class="b1"> Plagiarism and Academic Misconduct </div> {{dev}} <section begin=contents_summary /> In an open, network-based curriculum in which..." (and the only contributor was "Boris"))
- 04:23, 31 August 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 22:27, 30 August 2017 Boris talk contribs deleted page BIR-iGraph (content was: "<div id="BIO"> <div class="b1"> The iGraph Package </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Network analysis with iGraph </div> {{Vs..." (and the only contributor was "Boris"))
- 22:24, 30 August 2017 Boris talk contribs uploaded a new version of File:ABC-units map.svg
- 15:51, 28 August 2017 Boris talk contribs moved page BIN-ALI-Domains by sequence to BIN-FUNC-Domain annotation without leaving a redirect
- 19:09, 27 August 2017 Boris talk contribs moved page FND-PPI-Interactome to BIN-PPI-Analysis without leaving a redirect
- 19:39, 26 August 2017 Boris talk contribs moved page FND-EDA-Plotting to RPR-Plotting without leaving a redirect
- 19:35, 26 August 2017 Boris talk contribs deleted page FND-MAT-Network science (content was: "<div id="BIO"> <div class="b1"> Concepts of Network Science </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> Concepts of network science </di..." (and the only contributor was "Boris"))
- 19:34, 26 August 2017 Boris talk contribs moved page FND-MAT-Graph theory to FND-MAT-Graphs and networks without leaving a redirect
- 09:41, 25 August 2017 Boris talk contribs moved page FND-PPI-Measurements to BIN-PPI-Concepts without leaving a redirect
- 15:34, 24 August 2017 Boris talk contribs moved page FND-Information theory to FND-STA-Information theory without leaving a redirect
- 20:32, 23 August 2017 Boris talk contribs moved page BIN-ALI-PSI BLAST to BIN-ALI-PSI-BLAST without leaving a redirect
- 20:30, 23 August 2017 Boris talk contribs moved page BIN-Formats reference to BIN-Storing data without leaving a redirect
- 20:30, 23 August 2017 Boris talk contribs moved page BIN-Identifiers to BIN-Databases without leaving a redirect
- 20:29, 23 August 2017 Boris talk contribs moved page FND-Databases to BIN-Data integration without leaving a redirect
- 14:35, 18 August 2017 Boris talk contribs uploaded File:ABC-units map.svg
- 13:52, 18 August 2017 Boris talk contribs moved page BIN-SX-PDB to RPR-SX-PDB without leaving a redirect
- 12:34, 18 August 2017 Boris talk contribs deleted page Test (obsolete)
- 08:26, 18 August 2017 Boris talk contribs deleted page Random (Test only)
- 05:32, 17 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 23:15, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 23:08, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 22:49, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "== Abstract == <!-- included from "../components/RPR-Setup.components.wtxt", section: "abstract" --> ... {{Vspace}} == This unit ... == === Prerequisites === <!-- ..." (and the only contributor was "Boris"))
- 22:46, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 22:41, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 22:25, 16 August 2017 Boris talk contribs deleted page RPR-Setup (content was: "<div id="BIO"> <div class="b1"> Setup R to work with it </div> {{Vspace}} <div class="keywords"> <b>Keywords:</b> R projects; working with git version..." (and the only contributor was "Boris"))
- 13:18, 9 August 2017 Boris talk contribs uploaded File:ABC-Units map.jpeg
- 02:04, 7 August 2017 Boris talk contribs uploaded File:CreativeCommonsBy.png
- 16:35, 27 November 2016 Boris talk contribs moved page BIO Assignment Week X to BIO Assignment Week 7 without leaving a redirect (swap A07 with A08)
- 16:35, 27 November 2016 Boris talk contribs moved page BIO Assignment Week 7 to BIO Assignment Week 8 without leaving a redirect (swap A07 with A08)
- 16:34, 27 November 2016 Boris talk contribs moved page BIO Assignment Week 8 to BIO Assignment Week X without leaving a redirect (swap A07 with A08)
- 16:49, 17 October 2016 Boris talk contribs deleted page File:05-Structure LectureNotes.pdf
- 16:39, 17 October 2016 Boris talk contribs uploaded File:05-Structure LectureNotes.pdf
- 05:25, 15 October 2016 Boris talk contribs uploaded File:04-Sequence Alignment LectureNotes Part-2.pdf
- 05:24, 15 October 2016 Boris talk contribs uploaded File:04-Sequence Alignment LectureNotes Part-1.pdf
- 05:18, 12 October 2016 Boris talk contribs uploaded File:DomainAnnotations.jpg
- 05:18, 12 October 2016 Boris talk contribs deleted page File:DomainAnnotations.jpg
- 05:17, 12 October 2016 Boris talk contribs deleted page File:DomainAnnotations.jpg (Deleted old revision 20161012051715!DomainAnnotations.jpg)
- 05:17, 12 October 2016 Boris talk contribs deleted page File:DomainAnnotations.jpg (Deleted old revision 20161012051535!DomainAnnotations.jpg)
- 05:17, 12 October 2016 Boris talk contribs uploaded a new version of File:DomainAnnotations.jpg
- 05:15, 12 October 2016 Boris talk contribs uploaded a new version of File:DomainAnnotations.jpg
- 17:51, 29 September 2016 Boris talk contribs deleted page File:SystemDB Datamodel.png (Deleted old revision 20160929175123!SystemDB_Datamodel.png)
- 17:51, 29 September 2016 Boris talk contribs uploaded a new version of File:SystemDB Datamodel.png
- 15:47, 29 September 2016 Boris talk contribs deleted page File:SystemDB Datamodel.png (Deleted old revision 20160929154722!SystemDB_Datamodel.png)
- 15:47, 29 September 2016 Boris talk contribs uploaded a new version of File:SystemDB Datamodel.png
- 15:17, 29 September 2016 Boris talk contribs uploaded File:SystemDB Datamodel.png
- 15:16, 29 September 2016 Boris talk contribs deleted page File:SystemDB Datamodel.svg
- 15:08, 29 September 2016 Boris talk contribs uploaded File:SystemDB Datamodel.svg
- 18:47, 23 September 2016 Boris talk contribs uploaded a new version of File:ERD 04.jpg
- 15:16, 23 September 2016 Boris talk contribs deleted page File:ERD 04.jpg (Deleted old revision 20160923151535!ERD_04.jpg)
- 15:15, 23 September 2016 Boris talk contribs deleted page File:ERD 04.jpg (Deleted old revision 20160923151438!ERD_04.jpg)
- 15:15, 23 September 2016 Boris talk contribs deleted page File:ERD 04.jpg (Deleted old revision 20160923151412!ERD_04.jpg)
- 15:15, 23 September 2016 Boris talk contribs uploaded a new version of File:ERD 04.jpg
- 15:14, 23 September 2016 Boris talk contribs uploaded a new version of File:ERD 04.jpg (Reverted to version as of 06:28, 28 September 2015)
- 15:14, 23 September 2016 Boris talk contribs uploaded a new version of File:ERD 04.jpg
- 03:02, 23 September 2016 Boris talk contribs uploaded a new version of File:02-Data LectureNotes.pdf
- 23:41, 22 September 2016 Boris talk contribs uploaded File:02-Data LectureNotes.pdf
- 19:19, 7 February 2016 Boris talk contribs deleted page File:ProjectFolderAndFileLayout.png (Deleted old revision 20160207184434!ProjectFolderAndFileLayout.png)
- 18:44, 7 February 2016 Boris talk contribs uploaded a new version of File:ProjectFolderAndFileLayout.png
- 18:37, 7 February 2016 Boris talk contribs uploaded File:ProjectFolderAndFileLayout.png
- 18:36, 7 February 2016 Boris talk contribs deleted page File:ProjectFolderAndFileLayout.svg
- 15:11, 7 February 2016 Boris talk contribs uploaded File:ProjectFolderAndFileLayout.svg
- 21:25, 5 February 2016 Boris talk contribs deleted page CSB Quizzes (content was: "<div id="CSB"> <div class="b1"> Quizzes </div> The in-class quizzes will test your completion of the general tasks and readings for las..." (and the only contributor was "Boris"))
- 00:50, 3 February 2016 Boris talk contribs moved page BIO Quizzes to Eval Sessions without leaving a redirect
- 14:11, 2 February 2016 Boris talk contribs uploaded File:SPN Continuation.png
- 14:11, 2 February 2016 Boris talk contribs uploaded File:SPN Reference.png
- 14:11, 2 February 2016 Boris talk contribs uploaded File:SPN Note.png
- 14:11, 2 February 2016 Boris talk contribs uploaded File:SPN Braces.png
- 14:11, 2 February 2016 Boris talk contribs uploaded File:SPN Connector.png
- 14:10, 2 February 2016 Boris talk contribs uploaded File:SPN Branch.png
- 14:10, 2 February 2016 Boris talk contribs uploaded File:SPN ConnectingArrows.png
- 14:10, 2 February 2016 Boris talk contribs uploaded File:SPN MultiData.png
- 14:09, 2 February 2016 Boris talk contribs uploaded File:SPN Data.png
- 14:09, 2 February 2016 Boris talk contribs uploaded File:SPN Function.png
- 14:09, 2 February 2016 Boris talk contribs uploaded File:SPN Resource.png
- 14:08, 2 February 2016 Boris talk contribs uploaded File:SPN Activity.png
- 14:08, 2 February 2016 Boris talk contribs uploaded File:SPN Parameter.png
- 13:41, 2 February 2016 Boris talk contribs uploaded File:SPN ExampleProcess.png
- 12:02, 2 February 2016 Boris talk contribs uploaded File:SPN Core.png
- 15:54, 19 January 2016 Boris talk contribs moved page CSB Introduction to CSB Systems
- 23:27, 6 December 2015 Boris talk contribs uploaded a new version of File:GSE3635 ValueDistribution.png
- 23:26, 6 December 2015 Boris talk contribs uploaded a new version of File:GSE3635 ValueDistribution.png
- 17:23, 6 December 2015 Boris talk contribs uploaded a new version of File:GSE3635 ValueDistribution.png
- 17:16, 6 December 2015 Boris talk contribs uploaded File:GSE3635 ValueDistribution.png
- 01:41, 1 December 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 01:24, 1 December 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 01:22, 1 December 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:09, 29 November 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 13:53, 29 November 2015 Boris talk contribs uploaded a new version of File:FungiCladogram.jpg
- 13:40, 29 November 2015 Boris talk contribs uploaded a new version of File:FungiCladogram.jpg
- 13:27, 29 November 2015 Boris talk contribs uploaded a new version of File:FungiCladogram.jpg
- 05:58, 21 November 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 23:22, 18 November 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 05:42, 17 November 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:22, 27 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:13, 27 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:22, 26 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 05:32, 26 October 2015 Boris talk contribs moved page Reference KilA-N domains (reference species) to Reference APSES domains (reference species) without leaving a redirect
- 05:31, 26 October 2015 Boris talk contribs deleted page Reference KilA-N proteins (reference species) (obsolete)
- 13:47, 19 October 2015 Boris talk contribs uploaded File:1BM8 DNAbindingRegion stereo.jpg
- 12:30, 19 October 2015 Boris talk contribs uploaded File:1BM8 hbond stereo.jpg
- 12:28, 19 October 2015 Boris talk contribs deleted page File:1BM8 coulomb stereo.jpg (Deleted old revision 20151019122734!1BM8_coulomb_stereo.jpg)
- 12:27, 19 October 2015 Boris talk contribs uploaded a new version of File:1BM8 coulomb stereo.jpg (Reverted to version as of 11:34, 19 October 2015)
- 12:26, 19 October 2015 Boris talk contribs uploaded a new version of File:1BM8 coulomb stereo.jpg
- 11:34, 19 October 2015 Boris talk contribs uploaded a new version of File:1BM8 coulomb stereo.jpg
- 11:33, 19 October 2015 Boris talk contribs uploaded File:1BM8 coulomb stereo.jpg
- 11:26, 19 October 2015 Boris talk contribs uploaded File:1BM8 thermal stereo.jpg
- 02:16, 19 October 2015 Boris talk contribs uploaded File:1BM8 basic stereo.jpg
- 00:27, 19 October 2015 Boris talk contribs uploaded File:1DUX stereo.jpg
- 22:39, 18 October 2015 Boris talk contribs uploaded File:Caffeine stereo.jpg
- 23:21, 12 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:47, 12 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 17:34, 12 October 2015 Boris talk contribs uploaded a new version of File:DbUtilities.R
- 16:48, 12 October 2015 Boris talk contribs uploaded File:DbUtilities.R
- 18:24, 11 October 2015 Boris talk contribs uploaded File:RBM.jpg
- 02:41, 3 October 2015 Boris talk contribs moved page File:PoteinDataModel.1.jpg to File:ProteinDataModel.1.jpg without leaving a redirect
- 01:55, 3 October 2015 Boris talk contribs uploaded File:PoteinDataModel.1.jpg
- 06:28, 28 September 2015 Boris talk contribs uploaded File:ERD 04.jpg
- 06:28, 28 September 2015 Boris talk contribs uploaded File:ERD 03.jpg
- 06:28, 28 September 2015 Boris talk contribs uploaded File:ERD 02.jpg
- 05:53, 28 September 2015 Boris talk contribs uploaded a new version of File:ERD 01.jpg
- 05:10, 28 September 2015 Boris talk contribs uploaded a new version of File:ERD 01.jpg
- 04:55, 28 September 2015 Boris talk contribs uploaded File:ERD 01.jpg
- 21:06, 27 September 2015 Boris talk contribs uploaded File:DB MySQL-Workbench.jpg
- 17:04, 27 September 2015 Boris talk contribs uploaded File:DB Excel-spreadsheet.jpg
- 12:53, 27 September 2015 Boris talk contribs moved page Relational database principles to Data modelling without leaving a redirect
- 16:00, 26 September 2015 Boris talk contribs deleted page Reference APSES proteins (reference species) (content was: "#REDIRECT Reference KilA-N proteins (reference species)" (and the only contributor was "Boris"))
- 15:59, 26 September 2015 Boris talk contribs moved page Reference APSES proteins (reference species) to Reference KilA-N proteins (reference species)
- 14:06, 26 September 2015 Boris talk contribs deleted page Reference alignment for APSES domains (MUSCLE, reference species) (content was: "#REDIRECT Reference alignment for KilA-N domains (MUSCLE, reference species)" (and the only contributor was "Boris"))
- 14:06, 26 September 2015 Boris talk contribs moved page Reference alignment for APSES domains (MUSCLE, reference species) to Reference alignment for KilA-N domains (MUSCLE, reference species)
- 14:01, 26 September 2015 Boris talk contribs moved page Reference alignment for APSES domain proteins (PSI-BLAST) to Reference alignment for KilA-N domain proteins (PSI-BLAST) without leaving a redirect
- 13:46, 26 September 2015 Boris talk contribs moved page Reference APSES domains (reference species) to Reference KilA-N domains (reference species) without leaving a redirect
- 21:56, 22 September 2015 Boris talk contribs uploaded File:SubsettingExercises.R
- 17:55, 24 August 2015 Boris talk contribs uploaded File:Test.txt
- 16:56, 21 August 2015 Boris talk contribs uploaded File:EDA Regression.R
- 16:55, 21 August 2015 Boris talk contribs deleted page File:EDA Regression.R
- 16:54, 21 August 2015 Boris talk contribs uploaded a new version of File:EDA Regression.R
- 16:52, 21 August 2015 Boris talk contribs uploaded a new version of File:EDA Regression.R
- 14:28, 21 August 2015 Boris talk contribs uploaded File:ErroneusAnalysesOfSignificance-NatureNeuroscience2011.pdf
- 14:27, 21 August 2015 Boris talk contribs uploaded File:Tan 2015-NGSdifferentialTranscription.pdf
- 14:26, 21 August 2015 Boris talk contribs uploaded File:EDA HypothesisTesting.pdf
- 14:25, 21 August 2015 Boris talk contribs uploaded File:EDA HypothesisTesting.R
- 14:22, 21 August 2015 Boris talk contribs uploaded File:GSE26922.dat
- 14:20, 21 August 2015 Boris talk contribs uploaded File:EDA Clustering.pdf
- 14:19, 21 August 2015 Boris talk contribs uploaded File:EDA ClusteringExpressionData.R
- 14:17, 21 August 2015 Boris talk contribs uploaded File:EDA DimensionReduction.pdf
- 14:15, 21 August 2015 Boris talk contribs uploaded a new version of File:EDA DimensionReduction.R
- 13:01, 21 August 2015 Boris talk contribs uploaded File:EDA DimensionReduction.R
- 04:17, 21 August 2015 Boris talk contribs uploaded File:Logcho 237 4class.txt
- 17:03, 20 August 2015 Boris talk contribs uploaded File:SubsettingQuizAnswers.R
- 15:08, 20 August 2015 Boris talk contribs uploaded a new version of File:PlottingReference.R
- 14:23, 20 August 2015 Boris talk contribs uploaded File:EDA Regression.R
- 14:22, 20 August 2015 Boris talk contribs uploaded File:EDA Regression.pdf
- 14:19, 20 August 2015 Boris talk contribs uploaded File:GvHD.txt
- 14:16, 20 August 2015 Boris talk contribs uploaded File:EDA.pdf
- 14:14, 20 August 2015 Boris talk contribs uploaded File:EDA.R
- 05:30, 19 August 2015 Boris talk contribs uploaded a new version of File:Intro to R SampleSolutionsForTasks.R
- 05:30, 19 August 2015 Boris talk contribs uploaded a new version of File:Intro to R.R
- 04:11, 19 August 2015 Boris talk contribs uploaded File:Intro to R-slides.pdf
- 03:49, 19 August 2015 Boris talk contribs uploaded File:R refcard-data-mining.pdf
- 03:46, 19 August 2015 Boris talk contribs uploaded File:R refcard.pdf
- 03:39, 19 August 2015 Boris talk contribs uploaded File:PlottingReference.R
- 03:38, 19 August 2015 Boris talk contribs uploaded File:Intro to R SampleSolutionsForTasks.R
- 03:35, 19 August 2015 Boris talk contribs uploaded File:Weissgerber (2015) BeyondBarcharts.pdf
- 02:56, 19 August 2015 Boris talk contribs uploaded File:Table S3.csv
- 02:53, 19 August 2015 Boris talk contribs uploaded File:Table S3.xls
- 02:44, 19 August 2015 Boris talk contribs uploaded File:Fig 3-CharacteristicGenes.txt
- 02:42, 19 August 2015 Boris talk contribs uploaded File:Jaitin-SupplementaryMaterial.pdf
- 02:40, 19 August 2015 Boris talk contribs uploaded File:Jaitin 2014-SingleCellRNAseq.pdf
- 02:34, 19 August 2015 Boris talk contribs uploaded File:Intro to R.R
- 02:34, 19 August 2015 Boris talk contribs deleted page File:2015-08 Intro to R.R
- 02:32, 19 August 2015 Boris talk contribs uploaded File:2015-08 Intro to R.R
- 02:31, 19 August 2015 Boris talk contribs deleted page File:R Intro Module 1 First steps.R
- 16:16, 18 August 2015 Boris talk contribs uploaded File:R Intro Module 1 First steps.R
- 13:09, 18 August 2015 Boris talk contribs uploaded File:Utilities.R
- 12:59, 18 August 2015 Boris talk contribs uploaded a new version of File:ScriptTemplate.R
- 20:34, 29 April 2015 Boris talk contribs uploaded a new version of File:ScriptTemplate.R
- 20:47, 23 April 2015 Boris talk contribs uploaded File:ScriptTemplate.R
- 20:46, 23 April 2015 Boris talk contribs deleted page File:ScriptTemplate.txt
- 20:43, 23 April 2015 Boris talk contribs uploaded File:ScriptTemplate.txt
- 01:18, 16 January 2015 Boris talk contribs uploaded File:Introduction to SPN-02.jpg
- 01:13, 16 January 2015 Boris talk contribs uploaded File:Introduction to SPN-01.jpg
- 23:17, 7 December 2014 Boris talk contribs uploaded File:RefSpeciesTree.gif
- 01:11, 2 December 2014 Boris talk contribs deleted page Reference Mbp1 sequences (RBM) (content was: "__NOTOC__ These are sequences from six fungal species that are used as reference species for the course. The sequences all fulfill the Reciprocal Best Match (RBM) cr..." (and the only contributor was "Boris"))
- 01:10, 2 December 2014 Boris talk contribs deleted page Mbp1 RBM reference sequences (content was: "#REDIRECT Reference Mbp1 sequences (RBM)" (and the only contributor was "Boris"))
- 01:09, 2 December 2014 Boris talk contribs deleted page Reference APSES full length proteins (content was: "See Reference APSES domains (reference species) for procedure. <pre> >APS1_USTMA XP_762343 UM06196 MSGDKTIFKATYSGVPVYECIINNVAVMRRRSDDWLNATQILKVVGLDKPQRTRVLEREIQ..." (and the only contributor was "Boris"))
- 01:06, 2 December 2014 Boris talk contribs deleted page Mbp1 protein reference annotation (content was: "#REDIRECT Reference annotation yeast Mbp1" (and the only contributor was "Boris"))
- 01:02, 2 December 2014 Boris talk contribs moved page All Mbp1 proteins to Reference Mbp1 orthologues (all fungi) without leaving a redirect
- 00:51, 2 December 2014 Boris talk contribs deleted page Mbp1 annotation (content was: "#REDIRECT Mbp1 protein reference annotation" (and the only contributor was "Boris"))
- 20:56, 1 December 2014 Boris talk contribs moved page Reference APSES domain sequences (reference species) to Reference APSES domains (reference species) without leaving a redirect
- 20:50, 1 December 2014 Boris talk contribs deleted page APSES domains MUSCLE (content was: ";Output alignment generated with the MUSCLE webserver. The output is sorted in the same order as the |'''inpu..." (and the only contributor was "[[Special:Contributions/Boris|Boris"))
- 20:22, 1 December 2014 Boris talk contribs deleted page APSES domains CLUSTAL (content was: ";Output alignment generated with the CLUSTAL-W webserver. The output is sorted in the same order as the Reference APSES domain sequences (reference species)|'''inpu..." (and the only contributor was "Boris"))
- 20:20, 1 December 2014 Boris talk contribs moved page Reference APSES protein sequences (reference species) to Reference APSES proteins (reference species) without leaving a redirect
- 20:15, 1 December 2014 Boris talk contribs moved page Reference list of APSES protein sequences to Reference APSES protein sequences (reference species) without leaving a redirect
- 18:12, 1 December 2014 Boris talk contribs deleted page APSES domains MUSCLE revised (content was: "#REDIRECT Reference alignment for APSES domains" (and the only contributor was "Boris"))
- 18:10, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domain proteins (MUSCLE) to Reference alignment for APSES domains (MUSCLE, reference species) without leaving a redirect
- 18:07, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domains to Reference alignment for APSES domain proteins (MUSCLE) without leaving a redirect
- 17:41, 1 December 2014 Boris talk contribs deleted page All APSES domains (content was: "#REDIRECT Reference APSES domains" (and the only contributor was "Boris"))
- 17:40, 1 December 2014 Boris talk contribs moved page Reference APSES domains to Reference APSES domain sequences (reference species) without leaving a redirect
- 17:38, 1 December 2014 Boris talk contribs moved page APSES domains (yeast) to Reference APSES domains (yeast) without leaving a redirect
- 17:36, 1 December 2014 Boris talk contribs deleted page APSES domains probcons (content was: ";Output alignment generated with probcons. The probcons webserver will not accept input with more than 30 sequences, thus this alignment was performed on my workstati..." (and the only contributor was "Boris"))
- 17:35, 1 December 2014 Boris talk contribs deleted page Selected Mbp1 proteins (content was: "__NOTOC__ How this file was generated: ====The sequences==== <ol> <li>Copied the '''entire''' table from the Webpage</li> <li>Pasted it into an MSWord document. It ..." (and the only contributor was "Boris"))
- 17:34, 1 December 2014 Boris talk contribs deleted page Revised Mbp1 APSES domain tree (content was: ";How this tree was computed: Based on the notion that the Mbp1 clade that came out of the reference phylogenetic tree needed to be reviewed, the following steps were..." (and the only contributor was "Boris"))
- 17:30, 1 December 2014 Boris talk contribs deleted page All Mbp1 T-COFFEE (content was: "Result of T-COFFEE alignment of all Mbp1 protein orthologues. Default parameters. Output order of rows kept same as input order, i.e. according to sequence similarity..." (and the only contributor was "Boris"))
- 17:29, 1 December 2014 Boris talk contribs deleted page All Mbp1 CLUSTAL annotated (content was: "Result of CLUSTAL-W alignment of all Mbp1 protein orthologues. Default parameters. Sequence order was computed by CLUSTAL to place similar sequences in adjacent rows ..." (and the only contributor was "Boris"))
- 17:25, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domain proteins (PASI-BLAST) to Reference alignment for APSES domain proteins (PSI-BLAST) without leaving a redirect
- 17:24, 1 December 2014 Boris talk contribs moved page APSES domains reference tree to Reference tree for APSES domains without leaving a redirect
- 17:23, 1 December 2014 Boris talk contribs moved page All APSES proteins to Reference list of APSES protein sequences without leaving a redirect
- 17:21, 1 December 2014 Boris talk contribs deleted page All Mbp1 MUSCLE (content was: "Result of MUSCLE alignment of all Mbp1 protein orthologues. Default parameters, CLUSTAL ALN format. Output order of rows kept same as input order, i.e. according to s..." (and the only contributor was "Boris"))
- 17:20, 1 December 2014 Boris talk contribs deleted page All Mbp1 T-COFFEE annotated (content was: "Result of T-COFFEE alignment of all Mbp1 protein orthologues. Default parameters. Output order of rows kept same as input order, i.e. according to sequence similarity..." (and the only contributor was "Boris"))
- 17:17, 1 December 2014 Boris talk contribs moved page APSES domains PSI-BLAST to Reference alignment for APSES domain proteins (PASI-BLAST) without leaving a redirect
- 17:15, 1 December 2014 Boris talk contribs deleted page All APSES CLUSTAL score table (content was: ";Table of pair-scores returned by CLUSTAL SeqA Name Len(aa) SeqB Name Len(aa) Score ===========================================================..." (and the only contributor was "Boris"))
- 17:15, 1 December 2014 Boris talk contribs deleted page All Mbp1 CLUSTAL (content was: "Result of CLUSTAL-W alignment of all Mbp1 protein orthologues. Default parameters. Sequence order was computed by CLUSTAL to place similar sequences in adjacent rows ..." (and the only contributor was "Boris"))
- 17:14, 1 December 2014 Boris talk contribs moved page All Mbp1 MUSCLE annotated to Reference alignment for Mbp1 orthologues (MUSCLE) without leaving a redirect
- 17:14, 1 December 2014 Boris talk contribs moved page Reference alignment for Mbp1 proteins (T-COFFEE) to Reference alignment for Mbp1 orthologues (T-COFFEE) without leaving a redirect
- 17:12, 1 December 2014 Boris talk contribs deleted page All Mbp1 T-COFFEE scores (content was: "#REDIRECT Reference alignment for Mbp1 proteins (T-COFFEE)" (and the only contributor was "Boris"))
- 17:10, 1 December 2014 Boris talk contribs moved page All Mbp1 T-COFFEE scores to Reference alignment for Mbp1 proteins (T-COFFEE)
- 16:31, 1 December 2014 Boris talk contribs moved page APSES domains MUSCLE revised to Reference alignment for APSES domains
- 16:30, 1 December 2014 Boris talk contribs moved page Fungal reference species to Reference species for fungi
- 16:29, 1 December 2014 Boris talk contribs moved page Mbp1 protein reference annotation to Reference annotation yeast Mbp1
- 18:44, 10 September 2014 Boris talk contribs uploaded File:4IJE basic.jpg
- 18:43, 10 September 2014 Boris talk contribs uploaded File:4IJE stereo.jpg
- 18:09, 10 September 2014 Boris talk contribs uploaded File:1PUE demo 01 mono(POV).png
- 21:13, 4 September 2014 Boris talk contribs moved page BIO Open project to BIO project
- 16:38, 2 September 2014 Boris talk contribs moved page BCB410 2012 to BCB410
- 22:08, 14 January 2014 Boris talk contribs moved page Machine learning to BIO Machine learning without leaving a redirect (update)
- 22:08, 14 January 2014 Boris talk contribs deleted page BIO Machine learning (superfluous)
- 15:40, 14 January 2014 Boris talk contribs moved page CSB Mutual information to CSB Systems extraction without leaving a redirect
- 22:00, 13 December 2013 Boris talk contribs moved page Phylogenetic tree building to Phylogenetic tree interpretation without leaving a redirect
- 21:58, 13 December 2013 Boris talk contribs moved page Phylogenetic data interpretation to Phylogenetic inference without leaving a redirect
- 14:17, 12 December 2013 Boris talk contribs moved page Ab initio structure prediction to De novo structure prediction without leaving a redirect (More correct name)
- 21:23, 28 October 2013 Boris talk contribs uploaded File:AA-Venn.jpg
- 15:03, 5 October 2013 Boris talk contribs deleted page BIO Assignment Week 4 Annotation Supplement (No longer needed)
- 13:59, 23 September 2013 Boris talk contribs uploaded File:SebastianBrant-Ship (1549).jpg
- 14:41, 26 January 2013 Boris talk contribs deleted page GSEA (Redunant with "Enrichment")
- 16:46, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 12 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 12<br /> <span style="font-size: 70%">Structure and Function</span> </div> {{Template:Active}} Concepts and acti..." (and the only contributor was "Boris"))
- 16:46, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 11 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 11<br /> <span style="font-size: 70%">Calculating Phylogenies</span> </div> {{Template:Active}} Concepts and act..." (and the only contributor was "Boris"))
- 16:46, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 10 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 10<br /> <span style="font-size: 70%">Genome Browsers</span> </div> {{Template:Active}} Concepts and activities ..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 9 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 9<br /> <span style="font-size: 70%">Protein Ligand Complex</span> </div> {{Template:Active}} Concepts and activ..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 8 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 8<br /> <span style="font-size: 70%">Homology Modeling</span> </div> {{Template:Active}} Concepts and activities..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 7 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 7<br /> <span style="font-size: 70%">Multiple Sequence Alignment</span> </div> {{Template:Inactive}} Concepts an..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 6 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 6<br /> <span style="font-size: 70%">BLAST, Orthologues and Paralogues</span> </div> {{Template:Active}} Concept..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 5 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 5<br /> <span style="font-size: 70%">Sequence alignment </span> </div> {{Template:Active}} Concepts and activiti..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 4 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 4<br /> <span style="font-size: 70%">Domain annotations</span> </div> {{Template:Active}} Concepts and activitie..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 3 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 3<br /> <span style="font-size: 70%">Sequence Analysis</span> </div> <!-- {{Template:Inactive}} --> {{Template:Ac..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 2 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 2<br /> <span style="font-size: 70%">Scenario, Databases, Search and Retrieve</span> </div> <!-- {{Template:Incti..." (and the only contributor was "Boris"))
- 16:45, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO Assignment Week 1 (content was: "<div id="BIO"> <div class="b1"> Assignment for Week 1<br /> <span style="font-size: 70%">Introduction, VMD and R</span> </div> <!-- {{Template:Active}} --> {{Templat..." (and the only contributor was "Boris"))
- 16:11, 25 December 2012 Boris talk contribs moved page Feedback 2008 to BIO Feedback 2008 without leaving a redirect
- 16:11, 25 December 2012 Boris talk contribs moved page Feedback 2007 to BIO Feedback 2007 without leaving a redirect
- 16:07, 25 December 2012 Boris talk contribs deleted page User:Boris/Temp/BIO (content was: "<div id="BIO"> <div class="b1"> BCH441 - Bioinformatics <div style="font-size:50%;font-weight:normal;"> Welcome to the BCH441 Course Wiki. </div> </div> <small>'''T..." (and the only contributor was "Boris"))
- 01:51, 11 December 2012 Boris talk contribs deleted page Exam questions (content was: "#REDIRECT BCH441 Final Exam" (and the only contributor was "Boris"))
- 01:43, 11 December 2012 Boris talk contribs moved page Exam questions to BCH441 Final Exam
- 13:25, 26 November 2012 Boris talk contribs deleted page Organism list 2011 (content was: "#REDIRECT Species list 2011" (and the only contributor was "Boris"))
- 13:24, 26 November 2012 Boris talk contribs deleted page Species list 2011 (content was: "===The BCH441 Students & Species List (Fall 2011)=== Every student in the course is being assigned a species for study. Remember which species is listed here, ..." (and the only contributor was "Boris"))
- 19:59, 16 November 2012 Boris talk contribs deleted page Template:RepoPDF (content was: "{{#ifanon: | {{PDFlink|[http://{{#lst:User:{{#username:}}|pdf_repository_path}}/{{{1}}} {{{2}}}]}}}}" (and the only contributor was "Boris"))
- 02:24, 5 November 2012 Boris talk contribs uploaded a new version of File:ColoringByScore.jpg
- 02:15, 5 November 2012 Boris talk contribs uploaded a new version of File:QMeanScore.png
- 02:14, 5 November 2012 Boris talk contribs uploaded File:ModelledRange.png
- 02:12, 5 November 2012 Boris talk contribs restored page File:ModelledRange.png (1 revision restored)
- 02:12, 5 November 2012 Boris talk contribs deleted page File:ModelledRange.png
- 02:11, 5 November 2012 Boris talk contribs uploaded a new version of File:ModelledRange.png
- 02:10, 5 November 2012 Boris talk contribs deleted page File:ModelledRange.png (Deleted old revision 20121105021007!ModelledRange.png)
- 02:10, 5 November 2012 Boris talk contribs deleted page File:ModelledRange.png (Deleted old revision 20121105020844!ModelledRange.png)
- 02:10, 5 November 2012 Boris talk contribs uploaded a new version of File:ModelledRange.png
- 02:08, 5 November 2012 Boris talk contribs uploaded a new version of File:ModelledRange.png
- 15:00, 4 November 2012 Boris talk contribs uploaded File:InformationPlot.jpg
- 21:34, 28 October 2012 Boris talk contribs uploaded File:OrthologParalog.jpg
- 13:55, 28 October 2012 Boris talk contribs deleted page Template:PmSite (content was: "<table class="reference-box"><tr><td>{{#pmid:{{{1}}}}}<br />{{#if:{{{2|}}}| [ [{{{2|}}} Website] ]}}</td></tr></table>" (and the only contributor was "Boris"))
- 03:14, 7 October 2012 Boris talk contribs uploaded File:DomainAnnotations.jpg
- 15:00, 6 October 2012 Boris talk contribs moved page Mbp1 annotation to Mbp1 protein reference annotation
- 23:34, 21 September 2012 Boris talk contribs moved page Assignment 5 to BIO Assignment 5 2011 without leaving a redirect
- 23:34, 21 September 2012 Boris talk contribs moved page Assignment 4 to BIO Assignment 4 2011 without leaving a redirect
- 23:33, 21 September 2012 Boris talk contribs deleted page Assignment 2 (content was: "#REDIRECT BIO Assignment 2 2011" (and the only contributor was "Boris"))
- 23:32, 21 September 2012 Boris talk contribs moved page Assignment 3 to BIO Assignment 3 2011 without leaving a redirect
- 23:31, 21 September 2012 Boris talk contribs moved page Assignment 2 to BIO Assignment 2 2011
- 23:30, 21 September 2012 Boris talk contribs moved page Assignment 1 to BIO Assignment 1 2011 without leaving a redirect
- 19:33, 18 September 2012 Boris talk contribs uploaded File:01-2012 Introduction.pdf
- 16:46, 18 September 2012 Boris talk contribs uploaded File:Z-Ebrahim-Zadeh BCB410 2011 DynamicProgrammingExercises.pdf
- 16:42, 18 September 2012 Boris talk contribs uploaded File:Z-Ebrahim-Zadeh BCB410 2011 DynamicProgrammingPresentation.pdf
- 16:35, 18 September 2012 Boris talk contribs uploaded File:S-Shahsavand BCB410 2011 DockingExercises.pdf
- 16:35, 18 September 2012 Boris talk contribs uploaded File:S-Shahsavand BCB410 2011 DockingPresentation.pdf
- 15:52, 18 September 2012 Boris talk contribs uploaded File:O-Waghi BCB410 2011 PatternDiscoveryExercises.pdf
- 15:52, 18 September 2012 Boris talk contribs uploaded File:O-Waghi BCB410 2011 PatternDiscoveryPresentation.pdf
- 14:43, 18 September 2012 Boris talk contribs uploaded File:N-Nursimulu BCB410 2011 MSA-Exercises.pdf
- 14:39, 18 September 2012 Boris talk contribs uploaded File:N-Nursimulu BCB410 2011 MSA-Presentation.pdf
- 14:15, 18 September 2012 Boris talk contribs uploaded File:J-Wu BCB410 2011 HMM-Presentation.pdf
- 13:27, 18 September 2012 Boris talk contribs uploaded File:M-He BCB410 2011 R-ProgrammingExercises.pdf
- 13:26, 18 September 2012 Boris talk contribs uploaded File:M-He BCB410 2011 R-ProgrammingPresentation.pdf
- 10:51, 18 September 2012 Boris talk contribs uploaded File:J-Wu BCB410 2011 HMM-Exercises.pdf
- 10:45, 18 September 2012 Boris talk contribs deleted page File:J-Wu BCB410 2011 HMM-Presentation.pdf
- 02:40, 18 September 2012 Boris talk contribs uploaded File:J-Wu BCB410 2011 HMM-Presentation.pdf
- 13:18, 17 September 2012 Boris talk contribs uploaded File:HJ-Liu BCB410 2011 SADI-Exercises.pdf
- 13:17, 17 September 2012 Boris talk contribs uploaded File:HJ-Liu BCB410 2011 SADI-Presentation.pdf
- 11:03, 17 September 2012 Boris talk contribs uploaded File:JC-Somody BCB410 2011 GenomeAssemblyExercises.pdf
- 11:02, 17 September 2012 Boris talk contribs uploaded File:JC-Somody BCB410 2011 GenomeAssemblyPresentation.pdf
- 16:12, 16 September 2012 Boris talk contribs moved page Relational database example 2-join tables to Relational database example 3-join tables without leaving a redirect
- 16:12, 16 September 2012 Boris talk contribs moved page Relational database example 3-Perl interface to Relational database example 2-Perl interface without leaving a redirect
- 16:09, 16 September 2012 Boris talk contribs moved page Relational database to Relational database principles without leaving a redirect
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide11.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide10.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide09.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide08.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide07.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide06.png
- 16:00, 16 September 2012 Boris talk contribs uploaded File:DB Slide05.png
- 15:59, 16 September 2012 Boris talk contribs uploaded File:DB Slide04.png
- 15:59, 16 September 2012 Boris talk contribs uploaded File:DB Slide03.png
- 15:59, 16 September 2012 Boris talk contribs uploaded File:DB Slide02.png