BIN-ALI-MSA

Multiple Sequence Alignment

 

Keywords:  Multiple sequence alignment

 

 

Caution!

This unit is under development. There is some contents here but it is incomplete and/or may change significantly: links may lead to nowhere, the contents is likely going to be rearranged, and objectives, deliverables etc. may be incomplete or missing. Do not work with this material until it is updated to "live" status.

 

Abstract

...

 

This unit ...

Prerequisites

You need to complete the following units before beginning this one:

• BIN-ALI-Optimal_sequence_alignment (Optimal global and local sequence alignment)
• BIN-ALI-PSI-BLAST (PSI-BLAST)
• FND-STA-Information_theory (Concepts of Information Theory)

 

Objectives

This unit will ...

• ... introduce the benefits of multiple sequence alignments (MSA), the objective functions they pursue, algorithms and methods, practical considerations, and the analysis of alignments;
• ... demonstrate Web services that calculate MSAs;
• ... teach how to compute MSA's in R.

 

Outcomes

After working through this unit you ...

• ... can ;
• ... are familar with ;
• ... have begun to.

 

Deliverables

• Time management: Before you begin, estimate how long it will take you to complete this unit. Then, record in your course journal: the number of hours you estimated, the number of hours you worked on the unit, and the amount of time that passed between start and completion of this unit.
• Journal: Document your progress in your Course Journal. Some tasks may ask you to include specific items in your journal. Don't overlook these.
• Insights: If you find something particularly noteworthy about this unit, make a note in your insights! page.

 

Evaluation

Evaluation: Integrated Unit

This unit should be submitted for evaluation for a maximum of 10 marks. Details TBD.

 

Contents

Task:

• Read the introductory notes on concepts of multiple sequence alignments.

Multiple sequence alignments (MSAs) are enormously useful to resolve ambiguities in the precise placement of "indels" and to ensure that columns in alignments actually contain amino acids that evolve in a similar context. MSAs serve as input for

• functional annotation;
• protein homology modelling;
• phylogenetic analyses;
• sensitive homology searches in databases;
• and more.

Multiple Sequence Alignment

 

In order to perform a multiple sequence alignment, we obviously need a set of homologous sequences. This is not trivial. All interpretation of MSA results depends absolutely on how the input sequences were chosen. Should we include only orthologues, or paralogues as well? Should we include only species with fully sequenced genomes, or can we tolerate that some orthologous genes are possibly missing for a species? Should we include all sequences we can lay our hands on, or should we restrict the selection to a manageable number of representative sequences? All of these choices influence our interpretation:

• orthologues are expected to be functionally and structurally conserved;
• paralogues may have divergent function but have similar structure;
• missing genes may make paralogs look like orthologs; and
• selection bias may weight our results toward sequences that are over-represented and do not provide a fair representation of evolutionary divergence.

 

MSA's on the web at the EBI

 

The EBI hosts a number of excellent MSA program on their Website. Let's perform an MSA of full length MBP1 orthologues:

Task:

• Navigate to the NCBI protein database and paste the MBP1 protein RefSeq IDs from our database into the search form:

NP_010227 NP_593032 XP_660758 XP_007682304 XP_955821 XP_001837394
XP_569090 XP_003327086 XP_011392621 XP_006957051

(add your MBP1_MYSPE RefSeq ID too!)

• This will give you a page with links to the rtrieved sequences. Click on Format and choose FATA(text) to retrieve the multi-FASTA version of the retrieved sequences (this is useful, remember it!)
• Open another browser window and navigate to the EBI MSA tools page.
• Click on Launch T-coffee.
• Copy the FASTA sequences from the NCBI page, and paste them into the form at the EBI's T-Coffee page. Click Submit.
• The result should show you three blocks of aligned sequence: ...

Let's use the Bioconductor msa package to align the sequences we have. Study and run the following code

Computing an MSA in R

 

Let's use the Bioconductor msa package to align the sequences we have. Study and run the following code

Task:

• Return to your RStudio session.
• Make sure you have saved myDB as instructed previously.
• Bring code and data resources up to date:
  • pull the most recent version of the project from GitHub
  • type init() to lod the most recent files and functions
  • re-merge your current myDB
• Study and work through the code in the Multiple sequence alignments section of the BCH441_A04.R script.
• Note that the final task asks you to print out some results and bring them to class for the next quiz.

 

Sequence alignment editors

 

Really excellent software tools have been written that help you visualize and manually curate multiple sequence alignments. If anything, I think they tend to do too much. Past versions of the course have used Jalview, but I have heard good things of AliView (and if you are on a Mac seqotron might interest you, but I only cover software that is free and runs on all three major platforms).

Right now, I am just mentioning the two alignment editors. If you have experience with comparing them, let us know.

• [Jalview] an integrated MSA editor and sequence annotation workbench from the Barton lab in Dundee. Lots of functions.
• [AliView] from Uppsala: fast, lean, looks to be very practical.

 

Jalview: alignment editor

Geoff Barton's lab in Dundee has developed an integrated MSA editor and sequence annotation workbench with a number of very useful functions. It is written in Java and should run on Mac, Linux and Windows platforms without modifications.

Waterhouse et al. (2009) Jalview Version 2--a multiple sequence alignment editor and analysis workbench. Bioinformatics 25:1189-91. (pmid: 19151095)

[ PubMed ] [ DOI ] UNLABELLED: Jalview Version 2 is a system for interactive WYSIWYG editing, analysis and annotation of multiple sequence alignments. Core features include keyboard and mouse-based editing, multiple views and alignment overviews, and linked structure display with Jmol. Jalview 2 is available in two forms: a lightweight Java applet for use in web applications, and a powerful desktop application that employs web services for sequence alignment, secondary structure prediction and the retrieval of alignments, sequences, annotation and structures from public databases and any DAS 1.53 compliant sequence or annotation server. AVAILABILITY: The Jalview 2 Desktop application and JalviewLite applet are made freely available under the GPL, and can be downloaded from www.jalview.org.

We will quickly install Jalview and explore its features in other assignments.

Task:

1. Navigate to the Jalview homepage click on the Download link, and install Jalview on your computer. For Mac OS X, use the Install Jalview Only link.
2. Start Jalview. A number of windows that showcase the program's abilities will load, you can close these.
3. Select File → Input Alignment → from File and open the APSES_proteins.mfa file you have prepared above. An alignment window with sequences should appear.
4. Choose Web Service → Alignment → Tcoffee with Defaults to run a Tcoffee MSA remotely at the Barton lab. The program should execute remotely and download the aligned results into a new window. Scroll along the window to get a sense of what has and hasn't been aligned.
5. Select File → Input Alignment → from File and open the APSES_proteins_muscle.mfa file you have prepared above. An alignment window with your Muscle alignment should appear.
6. Compare the two alignments and get a sense for how similar or different they are.

Computing alignments

try two MSA's algorithms and load them in Jalview.
Locally: which one do you prefer? Modify the consensus. Annotate domains.

The EBI has a very convenient page to access a number of MSA algorithms. This is especially convenient when you want to compare, e.g. T-Coffee and Muscle and MAFFT results to see which regions of your alignment are robust. You could use any of these tools, just paste your sequences into a Webform, download the results and load into Jalview. Easy.

But even easier is to calculate the alignments directly from Jalview. available. (Not today. Bummer.)

No. Calculate an external alignment and import.

Calculate a MAFFT alignment using the Jalview Web service option

Task:

1. In Jalview, select Web Service → Alignment → MAFFT with defaults.... The alignment is calculated in a few minutes and displayed in a new window.

Calculate a MAFFT alignment when the Jalview Web service is NOT available

Task:

1. In Jalview, select File → Output to Textbox → FASTA
2. Copy the sequences.
3. Navigate to the MAFFT Input form at the EBI.
4. Paste your sequences into the form.
5. Click on Submit.
6. Close the Jalview sequence window and either save your MAFFT alignment to file and load in Jalview, or simply 'File → Input Alignment → from Textbox, paste and click New Window.

In any case, you should now have an alignment.

Task:

1. Choose Colour → Hydrophobicity and → by Conservation. Then adjust the slider left or right to see which columns are highly conserved. You will notice that the Swi6 sequence that was supposed to align only to the ankyrin domains was in fact aligned to other parts of the sequence as well. This is one part of the MSA that we will have to correct manually and a common problem when aligning sequences of different lengths.

Plot of information vs. sequence position produced by the R script above, for an alignment of Mbp1 ortholog APSES domains.

Calculating conservation scores

 Regex task:

Mutiple sequence alignment

 Write a program in a language of your choice that extracts the multi-line sequences from a CLUSTAL or MSF formatted multiple sequence alignment and concatenates them into single sequences .

Sample input data ...

CLUSTAL formatted alignment

 CLUSTAL multiple sequence alignment by MUSCLE (3.8)

SOK2_SACCE --NGISVVRRADNDMVNGTKLLN-----VTKMTRGRRDGILKAEKIR----------HVV PHD1_SACCE --NGISVVRRADNNMINGTKLLN-----VTKMTRGRRDGILRSEKVR----------EVV KILA_ESCCO -IDGEIIHLRAKDGYINATSMCRTAGKLLSDYTRLKTTQEFFDELSRDMGIPISELIQSF MBP1_SACCE IHSTGSIMKRKKDDWVNATHILK-----AANFAKAKRTRILEKEVLKETH-------EKV SWI4_SACCE ---TKIVMRRTKDDWINITQVFK-----IAQFSKTKRTKILEKESNDMQH-------EKV

* .:. :* * : . :. :. . : * .

SOK2_SACCE KIGSMHLKGVWIPFERALAIAQREKI-

 PHD1_SACCE      KIGSMHLKGVWIPFERAYILAQREQI-
 KILA_ESCCO      KGGRPENQGTWVHPDIAINLAQ-----
 MBP1_SACCE      QGGFGKYQGTWVPLNIAKQLAEKFSVY

SWI4_SACCE QGGYGRFQGTWIPLDSAKFLVNKYEI-

 ----

 ;MSF formatted alignment:
 PileUp

MSF: 87 Type: A Check: 0000 ..

Name: SOK2_SACCE Len: 87 Check: 9836 Weight: 0.160458 Name: PHD1_SACCE Len: 87 Check: 2117 Weight: 0.160458 Name: KILA_ESCCO Len: 87 Check: 6044 Weight: 0.256296 Name: MBP1_SACCE Len: 87 Check: 4979 Weight: 0.211395 Name: SWI4_SACCE Len: 87 Check: 5197 Weight: 0.211395

//

 SOK2_SACCE    ..NGISVVRR ADNDMVNGTK LLN.....VT KMTRGRRDGI LKAEKIR...

PHD1_SACCE ..NGISVVRR ADNNMINGTK LLN.....VT KMTRGRRDGI LRSEKVR... KILA_ESCCO .IDGEIIHLR AKDGYINATS MCRTAGKLLS DYTRLKTTQE FFDELSRDMG MBP1_SACCE IHSTGSIMKR KKDDWVNATH ILK.....AA NFAKAKRTRI LEKEVLKETH SWI4_SACCE ...TKIVMRR TKDDWINITQ VFK.....IA QFSKTKRTKI LEKESNDMQH

SOK2_SACCE .......HVV KIGSMHLKGV WIPFERALAI AQREKI. PHD1_SACCE .......EVV KIGSMHLKGV WIPFERAYIL AQREQI. KILA_ESCCO IPISELIQSF KGGRPENQGT WVHPDIAINL AQ..... MBP1_SACCE .......EKV QGGFGKYQGT WVPLNIAKQL AEKFSVY SWI4_SACCE .......EKV QGGYGRFQGT WIPLDSAKFL VNKYEI.

Write a regex for a valid sequence line. Capture the ID part and the sequence part separately. Use the ID part as a key to a hash, and add the sequence part to the value for that key.

Perl example

 :This code uses a regex that recognizes both CLUSTAL and MSF formats:
 :^(\w+) {2,}([A-Za-z.\- ]+)$
 :Capture a sequence of word characters, followed by at least two consecutive blank spaces, and capture a sequence of alphabetic characters, gap characters (- or .) or spaces until the end of line. Note that - needs to be escaped (\-) since it has the meaning of a character range in the context of a character class (i.e. square brackets. Lines that contain numerals fail the match, as well as lines that contain special characters, or lines that begin with spaces. Caution: this may not be fully compliant with the format specification.

  #!/usr/bin/perl
  use strict;
use warnings;

my %MSA;	# Hash to store the MSA
while (my $line = <STDIN>) {
  if ($line =~ m/^(\w+) {2,}([A-Za-z.\- ]+)$/) {
    my $k = $1;	# save special variables so they don't get mangled before using them
    my $v = $2;
    $v =~ s/\s//g;   # remove blanks in case there are any
    $MSA{$k} .= $v;  # "." is the perl string concatenation operator
  }
}
#Done. Now do something with the sequences ...
foreach my $k (keys(%MSA)) {
  print("$k: $MSA{$k}\n");
}

exit();

Model Based Alignments: PSSMs and HMMs

 

Position Specific Scoring Matrices (PSSMs)

The sensitivity of PSI-BLAST is based on the alignment of profiles of related sequences. The profiles are represented as position specific scoring matrices compiled from the alignment of hits, first to the original sequence and then to the profile. Incidentally, this process can also be turned around, and a collection of pre-compiled PSSMs can be used to annotate protein sequence: this is the principle employed by RPS-BLAST, the tool that identifies conserved domains at the beginning of every BLAST search, and has been used to build the CDD database of conserved domains (for a very informative help-page on CDD see here.

CDD domain annotation

In the last assignment, you followed a link to CDD Search Results from the RefSeq record for yeast Mbp1 and briefly looked at the information offered by the NCBI's Conserved Domain Database, a database of Position Specific Scoring Matrices that embody domain definitions. Rather than access precomputed results, you can also search CDD with sequences: assuming you have saved the MYSPE Mbp1 sequence in FASTA format, this is straightforward. If you did not save this sequence, return to Assignment 3 and retrieve it again.

Task:

1. Access the CDD database at http://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml
2. Read the information. CDD is a superset of various other database domain annotations as well as NCBI-curated domain definitions.
3. Copy the MYSPE Mbp1 FASTA sequence, paste it into the search form and click Submit.
   1. On the result page, clik on View full result
   2. Note that there are a number of partially overlapping ankyrin domain modules. We will study ankyrin domains in a later assignment.
   3. Also note that there may be blocks of sequence colored cyan in the sequence bar. Hover your mouse over the blocks to see what these blocks signify.
   4. Open the link to Search for similar domain architecture in a separate window and study it. This is the CDART database. Think about what these results may be useful for.
   5. Click on one of the ANK superfamily graphics and see what the associated information looks like: there is a summary of structure and function, links to specific literature and a tree of the relationship of related sequences.

Hidden Markov Models (HMMs)

An approach to represent such profile information that is more general than PSSMs is a Hidden Markov model (HMM) and the standard tool to use HMMs in Bioinformatics is HMMER, written by Sean Eddy. HMMER has allowed to represent the entirety of protein sequences as a collection of profiles, stored in databases such as Pfam, Interpro, and SMART. While the details are slightly different, all of these services allow to scan sequences for the presence of domains. Importantly thus, the alignment results are not collections of full-length protein families, but annotate to domain families, i.e. full length proteins are decomposed into their homologous domains. This is a very powerful approach towards the functional annotation of unknown sequences.

In this section, we will annotate the MYSPE sequence with the domains it contains, using the database of domain HMMs curated by SMART in Heidelberg and Pfam at the EMBL. We will then compare these annotations with those determined for the orthologues in the reference species. In this way we can enhance the information about one protein by determining how its features are conserved.

 

 

Further reading, links and resources

 

Bawono et al. (2017) Multiple Sequence Alignment. Methods Mol Biol 1525:167-189. (pmid: 27896722)

[ PubMed ] [ DOI ] The increasing importance of Next Generation Sequencing (NGS) techniques has highlighted the key role of multiple sequence alignment (MSA) in comparative structure and function analysis of biological sequences. MSA often leads to fundamental biological insight into sequence-structure-function relationships of nucleotide or protein sequence families. Significant advances have been achieved in this field, and many useful tools have been developed for constructing alignments, although many biological and methodological issues are still open. This chapter first provides some background information and considerations associated with MSA techniques, concentrating on the alignment of protein sequences. Then, a practical overview of currently available methods and a description of their specific advantages and limitations are given, to serve as a helpful guide or starting point for researchers who aim to construct a reliable MSA.

 

Benítez-Páez et al. (2012) A practical guide for the computational selection of residues to be experimentally characterized in protein families. Brief Bioinformatics 13:329-36. (pmid: 21930656)

[ PubMed ] [ DOI ] In recent years, numerous biocomputational tools have been designed to extract functional and evolutionary information from multiple sequence alignments (MSAs) of proteins and genes. Most biologists working actively on the characterization of proteins from a single or family perspective use the MSA analysis to retrieve valuable information about amino acid conservation and the functional role of residues in query protein(s). In MSAs, adjustment of alignment parameters is a key point to improve the quality of MSA output. However, this issue is frequently underestimated and/or misunderstood by scientists and there is no in-depth knowledge available in this field. This brief review focuses on biocomputational approaches complementary to MSA to help distinguish functional residues in protein families. These additional analyses involve issues ranging from phylogenetic to statistical, which address the detection of amino acids pivotal for protein function at any level. In recent years, a large number of tools has been designed for this very purpose. Using some of these relevant, useful tools, we have designed a practical pipeline to perform in silico studies with a view to improving the characterization of family proteins and their functional residues. This review-guide aims to present biologists a set of specially designed tools to study proteins. These tools are user-friendly as they use web servers or easy-to-handle applications. Such criteria are essential for this review as most of the biologists (experimentalists) working in this field are unfamiliar with these biocomputational analysis approaches.

Pais et al. (2014) Assessing the efficiency of multiple sequence alignment programs. Algorithms Mol Biol 9:4. (pmid: 24602402)

[ PubMed ] [ DOI ] BACKGROUND: Multiple sequence alignment (MSA) is an extremely useful tool for molecular and evolutionary biology and there are several programs and algorithms available for this purpose. Although previous studies have compared the alignment accuracy of different MSA programs, their computational time and memory usage have not been systematically evaluated. Given the unprecedented amount of data produced by next generation deep sequencing platforms, and increasing demand for large-scale data analysis, it is imperative to optimize the application of software. Therefore, a balance between alignment accuracy and computational cost has become a critical indicator of the most suitable MSA program. We compared both accuracy and cost of nine popular MSA programs, namely CLUSTALW, CLUSTAL OMEGA, DIALIGN-TX, MAFFT, MUSCLE, POA, Probalign, Probcons and T-Coffee, against the benchmark alignment dataset BAliBASE and discuss the relevance of some implementations embedded in each program's algorithm. Accuracy of alignment was calculated with the two standard scoring functions provided by BAliBASE, the sum-of-pairs and total-column scores, and computational costs were determined by collecting peak memory usage and time of execution. RESULTS: Our results indicate that mostly the consistency-based programs Probcons, T-Coffee, Probalign and MAFFT outperformed the other programs in accuracy. Whenever sequences with large N/C terminal extensions were present in the BAliBASE suite, Probalign, MAFFT and also CLUSTAL OMEGA outperformed Probcons and T-Coffee. The drawback of these programs is that they are more memory-greedy and slower than POA, CLUSTALW, DIALIGN-TX, and MUSCLE. CLUSTALW and MUSCLE were the fastest programs, being CLUSTALW the least RAM memory demanding program. CONCLUSIONS: Based on the results presented herein, all four programs Probcons, T-Coffee, Probalign and MAFFT are well recommended for better accuracy of multiple sequence alignments. T-Coffee and recent versions of MAFFT can deliver faster and reliable alignments, which are specially suited for larger datasets than those encountered in the BAliBASE suite, if multi-core computers are available. In fact, parallelization of alignments for multi-core computers should probably be addressed by more programs in a near future, which will certainly improve performance significantly.

Sievers & Higgins (2018) Clustal Omega for making accurate alignments of many protein sequences. Protein Sci 27:135-145. (pmid: 28884485)

[ PubMed ] [ DOI ] Clustal Omega is a widely used package for carrying out multiple sequence alignment. Here, we describe some recent additions to the package and benchmark some alternative ways of making alignments. These benchmarks are based on protein structure comparisons or predictions and include a recently described method based on secondary structure prediction. In general, Clustal Omega is fast enough to make very large alignments and the accuracy of protein alignments is high when compared to alternative packages. The package is freely available as executables or source code from www.clustal.org or can be run on-line from a variety of sites, especially the EBI www.ebi.ac.uk.

Iantorno et al. (2014) Who watches the watchmen? An appraisal of benchmarks for multiple sequence alignment. Methods Mol Biol 1079:59-73. (pmid: 24170395)

[ PubMed ] [ DOI ] Multiple sequence alignment (MSA) is a fundamental and ubiquitous technique in bioinformatics used to infer related residues among biological sequences. Thus alignment accuracy is crucial to a vast range of analyses, often in ways difficult to assess in those analyses. To compare the performance of different aligners and help detect systematic errors in alignments, a number of benchmarking strategies have been pursued. Here we present an overview of the main strategies-based on simulation, consistency, protein structure, and phylogeny-and discuss their different advantages and associated risks. We outline a set of desirable characteristics for effective benchmarking, and evaluate each strategy in light of them. We conclude that there is currently no universally applicable means of benchmarking MSA, and that developers and users of alignment tools should base their choice of benchmark depending on the context of application-with a keen awareness of the assumptions underlying each benchmarking strategy.

Notredame (2007) Recent evolutions of multiple sequence alignment algorithms. PLoS Comput Biol 3:e123. (pmid: 17784778)

[ PubMed ] [ DOI ]

 

Notes

 

Self-evaluation

 

 

---

 

If in doubt, ask! If anything about this learning unit is not clear to you, do not proceed blindly but ask for clarification. Post your question on the course mailing list: others are likely to have similar problems. Or send an email to your instructor.

---

 

About ...
 
Author:

Boris Steipe <boris.steipe@utoronto.ca>

Created:

2017-08-05

Modified:

2017-10-22

Version:

0.1

Version history:

• 0.1 First stub

---

This copyrighted material is licensed under a Creative Commons Attribution 4.0 International License. Follow the link to learn more.