BIO Assignment 5 2011

   

Assignment 5 - Homology modeling

 

Please note: This assignment is currently active. Important changes will be announced on the course mailing list.

 

 

How could the search for ultimate truth have revealed so hideous and visceral-looking an object?

Max Perutz (on his first glimpse of the Hemoglobin structure)

Where is the hidden beauty in structure, and where, the "ultimate truth"? In the previous assignments we have studied sequence conservation in APSES family domains and looked at how these domains have evolved over time. We have seen that this is an ancient family, that had several members already in the cenancestor of all fungi, an organism that lived in the vendian period of the proterozoic era of precambrian times, more than 600,000,000 years ago.

In order to understand how particular residues in the sequence contribute to the putative function of the protein, and why and how they are conserved throughout evolution, we would need to consider an explicit molecular model of an APSES domain protein, bound to its cognate DNA sequence. In particular, it would be interesting to correlate the conservation patterns we have observed in the MSAs with specific DNA binding interactions. Unfortunately, the 1MB1 structure does not have DNA bound and the evidence we have considered in Assignment 2 (Taylor et al., 2000) is not sufficient to define the details of how a DNA double helix might be bound. These details would require the structure of a complex that contains protein as well as DNA. No such complex of an APSES domain has yet been crystallized.

In this assignment you will construct a molecular model of the Mbp1 orthologue in your assigned organism, identify similar structures of distantly related domains for which protein-DNA complexes are known, define whether the available evidence allows you to distinguish between different modes of ligand binding, and assemble a hypothetical complex structure.

For the following, please remember the following terminology:

Target

The protein that you are planning to model.

Template

The protein whose structure you are using as a guide to build the model.

Model

The structure that results from the modeling process. It has the Target sequence and is similar to the Template structure.

 

A brief overview article on the construction and use of homology models is linked to the resource section at the bottom of this page. That section also contains links to other sites and resources you might require.

Preparation, submission and due date

Read carefully. Be sure you have understood all parts of the assignment and cover all questions in your answers! Sadly, we see too many assignments which, arduously effected, nevertheless intimate nescience of elementary tenets of molecular biology. If the sentence above did not trigger an urge to open a dictionary, you have a tendency to guess, rather than confirm possibly important information.

Prepare a Microsoft Word document with a title page that contains:

• your full name
• your Student ID
• your e-mail address
• the organism name you have been assigned

Follow the steps outlined below. You are encouraged to write your answers in short answer form or point form, like you would document an analysis in a laboratory notebook. However, you must

• document what you have done,
• note what Web sites and tools you have used,
• paste important data sequences, alignments, information etc.

If you do not document the process of your work, we will deduct marks. Try to be concise, not wordy! Use your judgement: are you giving us enough information so we could exactly reproduce what you have done? If not, we will deduct marks. Avoid RTF and unnecessary formating. Do not paste screendumps. Keep the size of your submission below 1.5 MB.

Write your answers into separate paragraphs and give each its title. Save your document with a filename of: A5_family name.given name.doc (for example my fifth assignment would be named: A5_steipe.boris.doc - and don't switch the order of your given name and familyname please!)

Finally e-mail the document to [mailto: boris.steipe@utoronto.ca] before the due date.

Your document must not contain macros. Please turn off and/or remove all macros from your Word document; we will disable macros, since they pose a security risk.

We do not have the resources to correct formatting errors or to convert assignments into different formats. Keep your image-file sizes manageable!

Image sizes are measured in pixels - 600px across is sufficient for the assignment, resolutions are measured in dpi (dots per imperial inch) - 72 dpi is the standard resolution for images that are viewed on a monitor; the displayed size may be scaled (in %) by an application program: stereo images should be presented so that equivalent points are approximately 6 cm apart; images can be stored uncompressed as .tiff or.bmp, or compressed as .gif or .jpg. .gif is preferred for images with large, monochrome areas and sharp, high-contrast edges; .jpg is preferred for images with shades and halftones such as the structure views required here; .tiff is preferred to archive master copies of images in a lossless fashion, use LZW compression for .tiff files if your system/application supports it; .bmp is not preferred for anything, its used because its easier to code.

Information that you present (such as added colouring, formatting etc.) should be meaningful. If you have technical difficulties, post your questions to the list and/or contact me.

All required stereo views are to be presented as divergent stereo frames (left eye's view in the left frame). Remember to list the Rasmol command input you have used to generate the images.

With the number of students in the course, we have to economize on processing the assignments. Thus we will not accept assignments that are not prepared as described above. If you have technical difficulties, contact me.

The due date for the assignment is Thursday, December 7. at 24:00 (last day of class). In case you need more time since the assignment was posted late, an extension is automatically granted to Tuesday, December 19. at 10:00 in the morning.

Grading

Don't wait until the last day to find out there are problems! This assignment has been structured so that it should be doable in three or four hours. The assignment is excellent preparation for the exam, so even if its due later, its a good idea to do it earlier. Assignments that are received past the due date will have one mark deducted at the first minute of every twelve hour period past the due date. Assignments received more than 5 days past the due date will not be assessed. If you need an extension, you must arrange this beforehand.

Marks are noted below in the section headings for of the tasks. A total of 10 marks will be awarded, if your assignment answers all of the questions. A total of 2 bonus marks (up to a maximum of 10 overall) can be awarded for particularily interesting findings, or insightful comments. A total of 2 marks can be subtracted for lack of form or for glaring errors. The marks you receive will

• count directly towards your final marks at the end of term, for BCH441 (undergraduates), or
• be divided by two for BCH1441 (graduates).

   

(1) Preparation

   

The input alignment (1 marks)

 

The sequence alignment between target and template is the single most important factor that determines the quality of your model.

No homology modeling process will repair an incorrect alignment and it is useful to consider a homology model rather like a three-dimensional map of a sequence alignment, rather than a structure in its own right. In a homology modeling project, typically the largest amount of time should be spent on preparing the best possible alignment. Even though automated servers like the SwissModel server will align sequences and select template structures for you, it would be unwise to use these just because they are convenient, rather than the more sophisticated methods and more informed procedures we have discussed. Detailed analysis of fallacious models rarely leads to good results.

The best possible alignment is usually constructed from a multiple sequence alignment that includes at least the target and template sequence and other related sequences as well. The additional sequences are an important aid in identifying the correct placement of insertions and deletions. Typically such an alignment will also include additional optimization steps to move insertions or deletions between target and template out of the secondary structure elements of the template structure.

Here is an excerpt from the T-coffee aligned Mbp1 sequences: it contains all the residues of the yeast sequence that are found in the 1MB1 crystal structure - the template sequence for our homology model - and it has been edited to remove the N-terminal gaps in the sequence. Thus the N-terminus is 21 amino acids longer than the definition of the APSES domain in CDD (which starts with SIMKR...), the C- terminus is slightly shorter.

Since the sequences are very similar between each other, there is no ambiguity in the alignment and the construction of a homology model should be straightforward. Normally one would spend considerable some effort at this stage to consider which parts of the target sequence and the template sequence appear to correctly aligned and to edit the alignment manually. In our case, evolutionary pressure was so strong that essentially all have evolved without a single indel in their sequence.

I have added to the alignment the APSES domain of XP_001224558, the Chaetomium globosum Mbp1 orthologue (MBP1_CHAGL). This will serve as the reference and fallback sequence.

1MB1            NQIYSARYSGVDVYEFIHSTG---SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEV
MBP1_CANGL      NQIYSAKYSGVDVYEFIHPTG---SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEV
MBP1_EREGO      TQIYSAKYSGVEVYEFLHPTG---SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEV
MBP1_KLULA      NQIYSAKYSGVDVYEFIHPTG---SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEV
MBP1_CANAL      SQIYSATYSNVPAFEFVTSEG---PIMRRKKDSWINATHILKIAKFPKAKRTRILEKDV
MBP1_DEBHA      TQIYSATYSNVPVFEFVTLEG---PIMRRKLDSWINATHILKIAKFPKAKRTRILEKDV
MBP1_YARLI      MSIYKATYSGVPVYEFQCKNV---AVMRRKSDGWVNATHILKVAGFDKPQRTRILEKEV
MBP1_SCHPO      SAVHVAVYSGVEVYECFIKGV---SVMRRRRDSWLNATQILKVADFDKPQRTRVLERQV
MBP1_USTMA      KTIFKATYSGVPVYECIINNV---AVMRRRSDDWLNATQILKVVGLDKPQRTRVLEREI
MBP1_ASPNI      SNVYSATYSSVPVYEFKIGTD---SVMRRRSDDWINATHILKVAGFDKPARTRILEREV
MBP1_ASPTE      SKIYSATYSSVPVYEFKIEGD---SVMRRRADDWINATHILKVAGFDKPARTRILEREV
MBP1_CRYNE      PKVYASVYSGVPVFEAMIRGI---SVMRRASDSWVNATQILKVAGVHKSARTKILEKEV
MBP1_GIBZE      G-IYSASYSGVDVYEMEVNNI---AVMRRRNDSWLNATQILKVAGVDKGKRTKILEKEI
MBP1_NEUCR      IYSLQATYSGVGVYEMEVNNV---AVMRRQKDGWVNATQILKVANIDKGRRTKILEKEI
MBP1_MAGGR      P-IYTAVYSNVEVYEFEVNGV---AVMKRIGDSKLNATQILKVAGVEKGKRTKILEKEI
MBP1_ASPFU      PQIYKAVYSNVSVYEMEVNGV---AVMKRRSDSWLNATQILKVAGVVKARRTKTLEKEI
MBP1_CHAGL      AGIYSATYSGIPVYEYQFGPDMKEHVMRRREDNWINATHILKAAGFDKPARTRILERDV

1MB1            LKETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLF
MBP1_CANGL      LKEMHEKVQGGFGKYQGTWVPLNIAINLAEKFDVYQDLKPLF
MBP1_EREGO      IKDTHEKVQGGFGKYQGTWVPLDIARRLAQKFEVLEELRPLF
MBP1_KLULA      ITDTHEKVQGGFGKYQGTWIPLELASKLAEKFEVLDELKPLF
MBP1_CANAL      QTGIHEKVQGGYGKYQGTYVPLDLGAAIARNFGVYDVLKPIF
MBP1_DEBHA      QTGVHEKVQGGYGKYQGTYVPLDLGADIAKNFGVFDSLRPIF
MBP1_YARLI      QKGVHEKVQGGYGKYQGTWVPLERAREIATLYDVDSHLAPIF
MBP1_SCHPO      QIGAHEKVQGGYGKYQGTWVPFQRGVDLATKYKVDGIMSPIL
MBP1_USTMA      QKGIHEKVQGGYGKYQGTWIPLDVAIELAERYNIQGLLQPIT
MBP1_ASPNI      QKGVHEKVQGGYGKYQGTWIPLQEGRQLAERNNILDKLLPIF
MBP1_ASPTE      QKGVHEKVQGGYGKYQGTWIPLPEGRLLAERNNIIDKLRPIF
MBP1_CRYNE      LNGIHEKIQGGYGKYQGTWVPLDRGRDLAEQYGVGSYLSSVF
MBP1_GIBZE      QTGEHEKVQGGYGKYQGTWIKFERGLQVCRQYGVEELLRPLL
MBP1_NEUCR      QIGEHEKVQGGYGKYQGTWIPFERGLEVCRQYGVEELLSKLL
MBP1_MAGGR      QTGEHEKVQGGYGKYQGTWIKYERALEVCRQYGVEELLRPLL
MBP1_ASPFU      AAGEHEKVQGGYGKYQGTWVNYQRGVELCREYHVEELLRPLL
MBP1_CHAGL      QKDVHEKIQGGYGKYQGTWIPLEQGRALAQRNNIYDRLRPIF

 

It should be obvious to you by now how you can copy a string of amino acids from such an alignment and create a FASTA file. However we need to take a little detour: this detour brings us to the question of sequence numbers.

It is not straightforward at all how to number sequence in such a project. The "natural" way would be to start a sequential numbering from the start-codon of the full length protein and go sequentially from there. However imagine what would happen if a curator would discover that one of the splice-sites for a gene has been missed in automatic annotation. All of a sudden a corrected sequence would have a different length than the one that may have been used for earlier studies. Unfortunatlety, there is no mechanism (wouldn't it be nice!) that automatically goes back through the literature and your lab-journal and updates the revised sequence numbering... But there are other possible complications, regarding sequence numbers. The first residue of the CDD-APSES domain is not Residue 1 of the Mbp1 protein. The first residue of the 1MB1 FASTA file is the first residue of Mbp1 protein, but the last five residues are an artifiical His tag. Is H125 of 1MB1 the equivalent residue to R125 in MBP1_SACCE? The N-terminus of the Mbp1 crystal structure is disordered. The first residue in the structure is ASN 3, whereas the SEQRES records start with MET ... and so on. The take-home message is that a sequence number is nothing absolute, but something that makes sense only in a particular context. To emphasize this, we will write a FASTA header for our target sequence that lists the residues of the source sequence it correspond to. In terms of actual sequence numbering, we will adopt the numbering of the 1MB1 protein throughout to be able to consistently label particular amino acids.

Access the sequence of "your" organism's Mbp1 Orthologue at UniProt. (You can use the links I have provided in the table below).

Organism	Uniprot Accession
Aspergillus fumigatus	Q4WGN2
Aspergillus nidulans	Q5B8H6
Aspergillus terreus	Q0CQJ5
Candida albicans	Q5ANP5
Candida glabrata	Q6FWD6
Cryptococcus neoformans	Q5KHS0
Debaryomyces hansenii	Q6BSN6
Eremothecium gossypii	Q752H3
Gibberella zeae	Q4IEY8
Kluyveromyces lactis	P39679
Magnaporthe grisea	Q3S405
Neurospora crassa	Q7SBG9
Saccharomyces cerevisiae	P39678
Schizosaccharomyces pombe	P41412
Ustilago maydis	Q4P117
Yarrowia lipolytica	Q6CGF5

• Copy your organism's Mbp1 sequence from the alignment above. Then define the start- and end- sequence numbers of the target sequence relative to the full-length protein. Prepare a FASTA formatted file for the target sequence in your organism, giving it an appropriate header and include the sequence numbers. Refer to the Fallback data file if you are not sure about the format. (1 mark)

 

Your FASTA sequence should look similar to this:

>1MB1: Mbp1_SACCE 1..100
NQIYSARYSGVDVYEFIHSTG---SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEV
LKETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLF

   

(2) Homology model

   

(2.1) SwissModel (1 mark)

 

Access the Swissmodel server at http://swissmodel.expasy.org . Navigate to the Alignment Interface.

 

• Copy from the alignment above the 1MB1 sequence and the sequence from your organism, and paste it into the form field. Refer to the Fallback Data file if you are not sure about the format.

(You have to choose the format, and, if e.g. you choose a CLUSTAL format, you have to include a header line and a blank line. Other common problems uploading your alignment may include uploading a file that has not been saved as "text only" and periods i.e. "." in sequence names. Underscores appear to be safe.)

• Click submit and define your target and template sequence. For the template sequence define the coordinate file and chain. (In our case the coordinate file is 1MB1 and the chain is "_" i.e. none, since the PDB file does not contain more than one chain.

• Click submit and request the construction of a homology model: Enter your e-mail address and check the button for Normal Mode, not "Swiss-PDB Viewer mode. (Important, since there will be problems with the output otherwise). Click submit. You should receive four files files by e-mail within half an hour or so. (1 mark)

(You do not need to submit any coordinate files with your assignment.)

 
In case you do not wish to submit the modelling job yourself, you can access the result files for the from the Fallback Data file.

(3) Model analysis

   

(3.1) The PDB file (1 mark)

 

Open your model coordinates in a text-editor (make sure you view the PDB file in a fixed-width font) and consider the following questions: (Alternatively, view the coordinates linked to the Fallback Data file.)

 

• What is the residue number of the first residue in the model? What should it be, based on the alignment? If the putative DNA binding region was reported to be residues 50-74 in the Mbp1 protein, which residues of the model correspond to that? (1 mark)

   

(3.2) first visualization (3 marks)

 

In assignment 2 you have already studied the 1MB1 coordinate file and compared it to your organism's Mbp1 APSES domain, Since a homology model inherits its structural details from the template, the model should look very similar to the original structure but contain the sequence of the target.

 

• Save the attachment of your model coordinates to your harddisk and visualize it in RasMol. (Alternatively, copy and save the coordinates from the Fallback Data file to your harddisk.) Make an informative view, divergent stereo and paste it into your assignment. (3 marks)

 

Stereo-view of a subdomain within the 1MB1 structure that includes residues 36 to 76. The color gradient ramps from blue (36) to green (76).

   

(3.3) modeling a DNA ligand (4 marks)

 

The really interesting question we could begin to address with our model is how sequence variation might be converted into changing DNA recognition sites, and then lead to changed cognate DNA binding sequences. But in order to address this, we would need to add a plausible model for a bound DNA molecule to our model.

Since there is currently no software available that would accurately model such a complex from first principles, we will base this on homology modeling as well. This means we need to find a similar structure for which the complex structure is known. However, you may remember from the third assignment that the APSES domains in fungi seem to be a relatively small family. And there is no structure available of a protein-DNA complex. Now what?

Remember that homologous sequences can have diverged to the point where their sequence similarity is no longer recognizable, however their structure may be quite well conserved. Thus if we could find similar structures in the PDB, these might provide us with some plausible hypotheses for how DNA is bound by APSES domains. We thus need a tool similar to BLAST, but not for the purpose of sequence alignment, but for structure alignment. A kind of BLAST for structures.

However, very similar to BLAST, we might not want to search with the entire protein, if all we are interested in is a subdomain that binds to DNA. Attempting to match all structural elements in addition to the ones we are actually interested in is likely to make the search less specific - we would find false positives that are similar to some irrelevant part of our structure. However, defining too small of a subdomain would also lead to a loss of specificity: in the extreme it is easy to imagine that the search for e.g. a single helix would retrieve very many hits that would be quite meaningless. The arrangement of the residues from 50 to 74 that we have already discussed in Assignment 2 suggests that the compact subdomain from 36 to 76 (see the image above) might be a useful structure to search with: it contains the residues we are interested in and enough of connected secondary structure elements to be structurally meaningful.

At the NCBI, VAST is a search tool for structural similarity search tool for this purpose. Unfortunately it does not seem to be able to handle a query with such a structural subdomain (the process did not finish after several days) but at least you can get a list of structural neighbors of the 1MB1 full-length template structure, by entering the PDB ID in a small form field on the VAST home page, and then clicking on the colored bar labeled "Chain" on the MMDB structure summary page. This precomputed page for the 1MB1 structure shows a number of diverse proteins matching to various helices and strands of the structure.

At the EBI there are a number of very well designed structure analysis tools linked off the Structural Analysis page. As part of its MSD Services, the SSM (Secondary Structure Matching service) provides a well thought out interface for searching files from the PDB or uploading coordinates.

After uploading the coordinates for residues 36 to 76 of the 1MB1 structure running the search and sorting the results by alignment length, the top hits include a number of nucleotide binding proteins such as a replication terminator (1F4K), the LexA repressor (1MVD) and a "Winged Helix" protein (1KQ8). These are all members of a much larger superfamily, the "winged helix" DNA binding domains (CATH 1.10.10.10), of which hundreds of structures have been solved. They represent one branch of the tree of helix-turn-helix (HTH) DNA binding modules. (A recent review on HTH proteins is linked from the resources section at the bottom of this page). Winged Helix domains typically bind their cognate DNA with a "recognition helix" which precedes the beta hairpin and binds into the major groove; additional stabilizing interactions are provided by the edge of the beta strand binding into the minor groove.

This is good news: once we have determined that the APSES domain is actually an example of a larger group of transcription factors, we can pick one of these for which a DNA complex structure is known. I have picked one such structure from the list of hits that were returned by SSM: it is the Elk-1 transcription factor.

1DUX). Note how the "recognition helix" inserts into the major groove of the DNA molecule. The color gradient ramps from blue (34) to green (84). Note how the first helix of the "helix-turn-helix" architecture serves only to position the recognition helix and makes few interactions by itself.

Now all that is left to do is to bring the DNA molecule into the correct orientation for our model and then to combine the two files. We need to superimpose the Elk-1 protein/DNA complex onto our model.

Structure superposition

There are quite a number of superposition servers available on the Web, a remarkably comprehensive overview can be found in Wikipedia. However, overengineering and black-box mentality makes our task more difficult than it need be: most tools do not allow users to specify particular alignment zones but attempt to automatically define the zones of residues to be supoerimposed according to some geometric target function. Almost none return the actual rotation matrix and translation vector that is used for the superposition. And almost none transform the coordinates of heteratoms such as solvent, ligands or DNA molecules along with the protein coordinates. An exception that I have found to be very useable is the Local-Global Alignment server (LGA), written by Adam Zemla. The procedure is quite straightforward:

• Define the structure to be rotated (1DUX in this case). This is a dimer, so download the file from the PDB and manually edit to contain only DNA chains A and B and protein chain C.
• Define the structure to be held constant (1MB1 in this case). Download from PDB.
• Use the "browse" option to define both files as input on the LGA inpput form
• Use the option to have both coordinate sets included in your output: -o2
• Submit

The results arrive per e-mail. I have linked the resulting PDB file to the Fallback Data page. If you run this analysis on your own, you may want to review the types of edits the edits I made to the PDB file to get it displayed correctly in Rasmol.

 

• Save the superimposed coordinates in a file, open and view in Rasmol and note how well the "recognition helix" and adjacent beta strands superimpose! (Alternatively, copy and save the coordinates from the c to your harddisk.) Make an informative view, divergent stereo and paste it into your assignment. (4 marks)

 
 

(4) Summary of Resources

 

Links

• Review (PDF, restricted) Manuel Peitsch on Homology Modeling
• Review (PDF, restricted) Aravind et al. Helix-turn-helix domains (background reading, not required reading)
• Assigned Organisms
• PDB file format
• Wikipedia on Structural Superposition (although the article is called "Structural Alignment")

• Fallback Data page

Alignments

Mbp1 proteins:

• Mbp1 proteins T-Coffee aligned (text version)

   

[End of assignment]

If you have any questions at all, don't hesitate to mail me at boris.steipe@utoronto.ca or post your question to the Course Mailing List