All public logs

Combined display of all available logs of "A B C". You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)

• 05:30, 19 August 2015 Boris talk contribs uploaded a new version of File:Intro to R.R
• 04:11, 19 August 2015 Boris talk contribs uploaded File:Intro to R-slides.pdf
• 03:49, 19 August 2015 Boris talk contribs uploaded File:R refcard-data-mining.pdf
• 03:46, 19 August 2015 Boris talk contribs uploaded File:R refcard.pdf
• 03:39, 19 August 2015 Boris talk contribs uploaded File:PlottingReference.R
• 03:38, 19 August 2015 Boris talk contribs uploaded File:Intro to R SampleSolutionsForTasks.R
• 03:35, 19 August 2015 Boris talk contribs uploaded File:Weissgerber (2015) BeyondBarcharts.pdf
• 02:56, 19 August 2015 Boris talk contribs uploaded File:Table S3.csv
• 02:53, 19 August 2015 Boris talk contribs uploaded File:Table S3.xls
• 02:44, 19 August 2015 Boris talk contribs uploaded File:Fig 3-CharacteristicGenes.txt
• 02:42, 19 August 2015 Boris talk contribs uploaded File:Jaitin-SupplementaryMaterial.pdf
• 02:40, 19 August 2015 Boris talk contribs uploaded File:Jaitin 2014-SingleCellRNAseq.pdf
• 02:34, 19 August 2015 Boris talk contribs uploaded File:Intro to R.R
• 02:34, 19 August 2015 Boris talk contribs deleted page File:2015-08 Intro to R.R
• 02:32, 19 August 2015 Boris talk contribs uploaded File:2015-08 Intro to R.R
• 02:31, 19 August 2015 Boris talk contribs deleted page File:R Intro Module 1 First steps.R
• 16:16, 18 August 2015 Boris talk contribs uploaded File:R Intro Module 1 First steps.R
• 13:09, 18 August 2015 Boris talk contribs uploaded File:Utilities.R
• 12:59, 18 August 2015 Boris talk contribs uploaded a new version of File:ScriptTemplate.R
• 20:34, 29 April 2015 Boris talk contribs uploaded a new version of File:ScriptTemplate.R
• 20:47, 23 April 2015 Boris talk contribs uploaded File:ScriptTemplate.R
• 20:46, 23 April 2015 Boris talk contribs deleted page File:ScriptTemplate.txt
• 20:43, 23 April 2015 Boris talk contribs uploaded File:ScriptTemplate.txt
• 01:18, 16 January 2015 Boris talk contribs uploaded File:Introduction to SPN-02.jpg
• 01:13, 16 January 2015 Boris talk contribs uploaded File:Introduction to SPN-01.jpg
• 23:17, 7 December 2014 Boris talk contribs uploaded File:RefSpeciesTree.gif
• 01:11, 2 December 2014 Boris talk contribs deleted page Reference Mbp1 sequences (RBM) (content was: "__NOTOC__ These are sequences from six fungal species that are used as reference species for the course. The sequences all fulfill the Reciprocal Best Match (RBM) cr..." (and the only contributor was "Boris"))
• 01:10, 2 December 2014 Boris talk contribs deleted page Mbp1 RBM reference sequences (content was: "#REDIRECT Reference Mbp1 sequences (RBM)" (and the only contributor was "Boris"))
• 01:09, 2 December 2014 Boris talk contribs deleted page Reference APSES full length proteins (content was: "See Reference APSES domains (reference species) for procedure. <pre> >APS1_USTMA XP_762343 UM06196 MSGDKTIFKATYSGVPVYECIINNVAVMRRRSDDWLNATQILKVVGLDKPQRTRVLEREIQ..." (and the only contributor was "Boris"))
• 01:06, 2 December 2014 Boris talk contribs deleted page Mbp1 protein reference annotation (content was: "#REDIRECT Reference annotation yeast Mbp1" (and the only contributor was "Boris"))
• 01:02, 2 December 2014 Boris talk contribs moved page All Mbp1 proteins to Reference Mbp1 orthologues (all fungi) without leaving a redirect
• 00:51, 2 December 2014 Boris talk contribs deleted page Mbp1 annotation (content was: "#REDIRECT Mbp1 protein reference annotation" (and the only contributor was "Boris"))
• 20:56, 1 December 2014 Boris talk contribs moved page Reference APSES domain sequences (reference species) to Reference APSES domains (reference species) without leaving a redirect
• 20:50, 1 December 2014 Boris talk contribs deleted page APSES domains MUSCLE (content was: ";Output alignment generated with the MUSCLE webserver. The output is sorted in the same order as the |'''inpu..." (and the only contributor was "[[Special:Contributions/Boris|Boris"))
• 20:22, 1 December 2014 Boris talk contribs deleted page APSES domains CLUSTAL (content was: ";Output alignment generated with the CLUSTAL-W webserver. The output is sorted in the same order as the Reference APSES domain sequences (reference species)|'''inpu..." (and the only contributor was "Boris"))
• 20:20, 1 December 2014 Boris talk contribs moved page Reference APSES protein sequences (reference species) to Reference APSES proteins (reference species) without leaving a redirect
• 20:15, 1 December 2014 Boris talk contribs moved page Reference list of APSES protein sequences to Reference APSES protein sequences (reference species) without leaving a redirect
• 18:12, 1 December 2014 Boris talk contribs deleted page APSES domains MUSCLE revised (content was: "#REDIRECT Reference alignment for APSES domains" (and the only contributor was "Boris"))
• 18:10, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domain proteins (MUSCLE) to Reference alignment for APSES domains (MUSCLE, reference species) without leaving a redirect
• 18:07, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domains to Reference alignment for APSES domain proteins (MUSCLE) without leaving a redirect
• 17:41, 1 December 2014 Boris talk contribs deleted page All APSES domains (content was: "#REDIRECT Reference APSES domains" (and the only contributor was "Boris"))
• 17:40, 1 December 2014 Boris talk contribs moved page Reference APSES domains to Reference APSES domain sequences (reference species) without leaving a redirect
• 17:38, 1 December 2014 Boris talk contribs moved page APSES domains (yeast) to Reference APSES domains (yeast) without leaving a redirect
• 17:36, 1 December 2014 Boris talk contribs deleted page APSES domains probcons (content was: ";Output alignment generated with probcons. The probcons webserver will not accept input with more than 30 sequences, thus this alignment was performed on my workstati..." (and the only contributor was "Boris"))
• 17:35, 1 December 2014 Boris talk contribs deleted page Selected Mbp1 proteins (content was: "__NOTOC__ How this file was generated: ====The sequences==== <ol> <li>Copied the '''entire''' table from the Webpage</li> <li>Pasted it into an MSWord document. It ..." (and the only contributor was "Boris"))
• 17:34, 1 December 2014 Boris talk contribs deleted page Revised Mbp1 APSES domain tree (content was: ";How this tree was computed: Based on the notion that the Mbp1 clade that came out of the reference phylogenetic tree needed to be reviewed, the following steps were..." (and the only contributor was "Boris"))
• 17:30, 1 December 2014 Boris talk contribs deleted page All Mbp1 T-COFFEE (content was: "Result of T-COFFEE alignment of all Mbp1 protein orthologues. Default parameters. Output order of rows kept same as input order, i.e. according to sequence similarity..." (and the only contributor was "Boris"))
• 17:29, 1 December 2014 Boris talk contribs deleted page All Mbp1 CLUSTAL annotated (content was: "Result of CLUSTAL-W alignment of all Mbp1 protein orthologues. Default parameters. Sequence order was computed by CLUSTAL to place similar sequences in adjacent rows ..." (and the only contributor was "Boris"))
• 17:25, 1 December 2014 Boris talk contribs moved page Reference alignment for APSES domain proteins (PASI-BLAST) to Reference alignment for APSES domain proteins (PSI-BLAST) without leaving a redirect
• 17:24, 1 December 2014 Boris talk contribs moved page APSES domains reference tree to Reference tree for APSES domains without leaving a redirect

(newest | oldest) View (newer 50 | older 50) (20 | 50 | 100 | 250 | 500)