Glossary
Jump to navigation
Jump to search
E-value
- Expectation-value of a BLAST search
The E-value reported for each BLAST-hit represents the number of alternate alignments, with the same or better total score, that could be expected to occur in the database purely by chance. Thus, the lower the E-value, the more significant the match. The value depends upon the quality and length of the alignment, as well as the size of the database.
FASTA format
- FASTA is a simple, ASCII based, text-file format for biological sequences. Minimally a FASTA file comprises a header line, initiated with the ">" character, followed by one or more lines containing nucleic acid or protein sequence in one-letter code. This is the most common input format for bioinformatics analysis programs and services.
- Example
>gi|3402004|pdb|1MB1| Mbp1 From Saccharomyces Cerevisiae MSNQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGF GKYQGTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASPPPAPKHHHASKVDHHHHHH
HSP
- High Scoring Pair
The fundamental unit of BLAST output. An HSP consists of an ungapped, local alignment result.
- Example
>ref|NP_012165.1| Transcriptional repressor that binds to promoter sequences of the cyclin genes, CYS3, and SMF2; expression is induced by stress or starvation during mitosis, and late in meiosis; member of the Swi4p/Mbp1p family; potential Cdc28p substrate; Xbp1p [Saccharomyces cerevisiae] Length=647 Score = 50.7 bits (122), Expect = 1e-06, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 4/43 (9%) Query 42 KVQGGFGKYQGTWVPLNIAKQLAEK +++GG+ K QGTW+P+ I++ L + F + L P+F DF Sbjct 347 RIRGGYIKIQGTWLPMEISRLLCLRFCFPIRYFLVPIFGPDFP 389
multi FASTA file
- A sequence file that contains more than one FASTA formatted sequence. The sequences are simply concatenated. This is a common input format for multiple sequence alignment or motif-finding programs.
- Example
>Homeobox associated Leucine Zipper from gi|3868845 (134..178) KQTEVDCELLRKCCASLTEENRRLQMEVDQLRALSTTQLHFSDFV >Homeobox associated Leucine Zipper from gi 21264431 (168..212) KQTEVDCEFLKKCCETLADENIRLQKEIQELKTLKLTQPFYMHMP >Homeobox associated Leucine Zipper from gi|6634483 (212.. 256) KQTEVDCELLKRCCETLTDENRRLHRELQELRALKLATAAAAPHH