Difference between revisions of "BIO Assignment Week 4"

From "A B C"
Jump to navigation Jump to search
m
m
Line 818: Line 818:
 
-->
 
-->
  
 +
 +
==Introduction==
 +
 +
In the last assignment we discovered homologs to ''S. cerevisiae'' Mbp1 in YFO. Some of these will be orthologs to Mbp1, some will be paralogs. Some will have similar function, some will not. We discussed previously that genes that evolve under continuously similar evolutionary pressure should be most similar in sequence, and should have the most similar "function".
 +
 +
In this assignment we will define the YFO gene that is the most similar ortholog to ''S. cerevisiae'' Mbp1, and perform a multiple sequence alignment with it.
 +
 +
Let us briefly review the basic concepts.
 +
 +
==Orthologs and Paralogs revisited==
 +
 +
<div style="padding: 2px; background: #F0F1F7;  border:solid 1px #AAAAAA; font-size:125%;color:#444444">
 +
 +
&nbsp;<br>
 +
;All related genes are homologs.
 +
</div>
 +
 +
 +
Two central definitions about the mutual relationships between related genes go back to Walter Fitch who stated them in the 1970s:
 +
<div style="padding: 2px; background: #F0F1F7;  border:solid 1px #AAAAAA; font-size:125%;color:#444444">
 +
 +
&nbsp;<br>
 +
;Orthologs have diverged after speciation.
 +
 +
;Paralogs have diverged after duplication.
 +
</div>
 +
 +
 +
&nbsp;
 +
 +
 +
[[Image:OrthologParalog.jpg|frame|none|'''Hypothetical evolutionary tree.''' A single gene evolves through two speciation events and one duplication event. A duplication occurs during the evolution from reptilian to synapsid. It is easy to see how this pair of genes (paralogs) in the ancestral synapsid gives rise to two pairs of genes in pig and elephant, respectively. All ''circle'' genes are mutually orthologs, they form a "cluster of orthologs". All genes within one species are mutual paralogs&ndash;they are so called ''in-paralogs''. The ''circle'' gene in pig and the ''triangle'' gene in the elephant are so-called ''out-paralogs''. Somewhat counterintuitively, the ''triangle'' gene in the pig and the ''circle'' gene in the raven are also orthologs - but this has to be, since the last common ancestor diverged by '''speciation'''.
 +
 +
The "phylogram" on the right symbolizes the amount of evolutionary change as proportional to height difference to the "root". It is easy to see how a bidirectional BLAST search will only find pairs of most similar orthologs. If applied to a group of species, bidirectional BLAST searches will find clusters of orthologs only (except if genes were lost, or there are  anomalies in the evolutionary rate.)]]
 +
 +
 +
==Defining orthologs==
 +
 +
To be reasonably certain about orthology relationships, we would need to construct and analyze detailed evolutionary trees. This is computationally expensive and the results are not always unambiguous either, as we will see in a later assignment. But a number of different strategies are available that use precomputed results to define orthologs. These are especially useful for large, cross genome surveys. They are less useful for detailed analysis of individual genes. Pay the sites a visit and try a search.
 +
 +
 +
;Orthologs by eggNOG
 +
:The [http://eggnog.embl.de/ '''eggNOG'''] (evolutionary genealogy of genes: Non-supervised Orthologous Groups) database contains orthologous groups of genes at the EMBL. It seems to be continuously updtaed, the search functionality is reasonable and the results for yeast Mbp1 show many genes from several fungi. Importantly, there is only one gene annotated for each species. Alignments and trees are also available, as are database downloads for algorithmic analysis.
 +
<div class="mw-collapsible mw-collapsed" data-expandtext="more..." data-collapsetext="less" style="width:800px">
 +
&nbsp;
 +
<div class="mw-collapsible-content">
 +
 +
{{#pmid: 24297252}}
 +
 +
</div>
 +
</div>
 +
 +
 +
;Orthologs at OrthoDB
 +
:[http://www.orthodb.org/ '''OrthoDB'''] includes a large number of species, among them all of our protein-sequenced fungi. However the search function (by keyword) retrieves many paralogs together with the orthologs, for example, the yeast Soc2 and Phd1 proteins are found in the same orthologous group these two are clearly paralogs.
 +
<div class="mw-collapsible mw-collapsed" data-expandtext="more..." data-collapsetext="less" style="width:800px">
 +
&nbsp;
 +
<div class="mw-collapsible-content">
 +
 +
{{#pmid: 23180791}}
 +
 +
</div>
 +
</div>
 +
 +
 +
;Orthologs at OMA
 +
[http://omabrowser.org/ '''OMA'''] (the Orthologous Matrix) maintained at the Swiss Federal Institute of Technology contains a large number of orthologs from sequenced genomes. Searching with <code>MBP1_YEAST</code> (this is the Swissprot ID) as a "Group" search finds the correct gene in EREGO, KLULA, CANGL and SACCE. But searching with the sequence of the ''Ustilago maydis'' ortholog does not find the yeast protein, but the orthologs in YARLI, SCHPO, LACCBI, CRYNE and USTMA. Apparently the orthologous group has been split into several subgroups across the fungi. However as a whole the database is carefully constructed and available for download and API access; a large and useful resource.
 +
<div class="mw-collapsible mw-collapsed" data-expandtext="more..." data-collapsetext="less" style="width:800px">
 +
&nbsp;
 +
<div class="mw-collapsible-content">
 +
 +
{{#pmid: 21113020}}
 +
 +
... see also the related articles, much innovative and carefully done work on automated orthologue definition by the Dessimoz group.
 +
</div>
 +
</div>
 +
 +
 +
;Orthologs by syntenic gene order conservation
 +
:We will revisit this when we explore the UCSC genome browser.
 +
 +
 +
;Orthologs by RBM
 +
:Defining it yourself. RBM (or: Reciprocal Best Match) is easy to compute and half of the work you have already done in [[BIO_Assignment_Week_3|Assignment 3]]. Get the ID for the gene which you have identified and annotated as the best BLAST match for Mbp1 in YFO and confirm that this gene has Mbp1 as the most significant hit in the yeast proteome. <small>The results are unambiguous, but there may be residual doubt whether these two best-matching sequences are actually the most similar orthologs.</small>
 +
 +
{{task|1=
 +
# Navigate to the BLAST homepage.
 +
# Paste the YFO RefSeq sequence identifier into the search field. (You don't have to search with sequences&ndash;you can search directly with an NCBI identifier '''IF''' you want to search with the full-length sequence.)
 +
# Set the database to refseq, and restrict the species to ''Saccharomyces cerevisiae''.
 +
# Run BLAST.
 +
# Keep the window open for the next task.
 +
 +
The top hit should be yeast Mbp1 (NP_010227). E mail me your sequence identifiers if it is not.
 +
If it is, you have confirmed the '''RBM''' or '''BBM''' criterion (Reciprocal Best Match or Bidirectional Best Hit, respectively).
 +
 +
<small>Technically, this is not perfectly true since you have searched with the APSES domain in one direction, with the full-length sequence in the other. For this task I wanted you to try the ''search-with-accession-number''. Therefore the procedural laxness, I hope it is permissible. In fact, performing the reverse search with the YFO APSES domain should actually be more stringent, i.e. if you find the right gene with the longer sequence, you are even more likely to find the right gene with the shorter one.</small>
 +
}}
 +
 +
 +
;Orthology by annotation
 +
:The NCBI precomputes BLAST results and makes them available at the RefSeq database entry for your protein.
 +
 +
{{task|1=
 +
# In your BLAST result page, click on the RefSeq link for your query to navigate to the RefSeq database entry for your protein.
 +
# Follow the '''Blink''' link in the right-hand column under '''Related information'''.
 +
# Restrict the view RefSeq under the "Display options" and to Fungi.
 +
 +
You should see a number of genes with low E-values and high coverage in other fungi - however this search is problematic since the full length gene across the database finds mostly Ankyrin domains.
 +
}}
 +
 +
 +
You will find that '''all''' of these approaches yield '''some''' of the orthologs. But none finds them all. The take home message is: precomputed results are good for large-scale survey-type investigations, where you can't humanly process the information by hand. But for more detailed questions, careful manual searches are still indsipensable.
 +
 +
<div class="mw-collapsible mw-collapsed" data-expandtext="Expand for crowdsourcing" data-collapsetext="Collapse">
 +
;Orthology by crowdsourcing
 +
:Luckily a crowd of willing hands has prepared the necessary sequences for you: in the section below you will find a link to the annotated and verified Mbp1 orthologs from last year's course  :-)
 +
 +
<div class="mw-collapsible-content">
 +
We could call this annotation by many hands {{WP|Crowdsourcing|"crowdsourcing"}} - handing out small parcels of work to many workers, who would typically allocate only a small share of their time, but here the strength is in numbers and especially projects that organize via the Internet can tally up very impressive manpower, for free, or as {{WP|Microwork}}. These developments have some interest for bioinformatics: many of our more difficult tasks  can not be easily built into an algorithm, language related tasks such as text-mining, or pattern matching tasks come to mind. Allocating this to a large number of human contributors may be a viable alternative to computation. A marketplace where this kind of work is already a reality is {{WP|Amazon Mechanical Turk|Amazon's "Mechanical Turk" Marketplace}}: programmers&ndash;"requesters"&ndash; use an open interface to post tasks for payment, "providers" from all over the world can engage in these. Tasks may include matching of pictures, or evaluating the aesthetics of competing designs. A quirky example I came across recently was when information designer David McCandless had 200 "Mechanical Turks" draw a small picture of their soul for his collection.
 +
 +
The name {{WP|The Turk|"Mechanical Turk"}} by the way relates to a famous ruse, when a Hungarian inventor and adventurer toured the imperial courts of 18<sup>th</sup> century Europe with an automaton, dressed in turkish robes and turban, that played chess at the grandmaster level against opponents that included Napoleon Bonaparte and Benjamin Franklin. No small mechanical feat in any case, it was only in the 19<sup>th</sup> century that it was revealed that the computational power was actually provided by a concealed human.
 +
 +
Are you up for some "Turking"? Before the next quiz, edit [http://biochemistry.utoronto.ca/steipe/abc/students/index.php/BCH441_2014_Assignment_7_RBM '''the Mbp1 RBM page on the Student Wiki] and include the RBM for Mbp1, for a 10% bonus on the next quiz.
 +
 +
</div>
 +
</div>
 +
 +
 +
&nbsp;
 +
 +
==Align and Annotate==
 +
 +
 +
&nbsp;<br>
 +
 +
 +
===Review of domain annotations===
 +
 +
 +
APSES domains are relatively easy to identify and annotate but we have had problems with the ankyrin domains in Mbp1 homologues. Both CDD as well as SMART have identified such domains, but while the domain model was based on the same Pfam profile for both, and both annotated approximately the same regions, the details of the alignments and the extent of the predicted region was different.
 +
 +
[http://www.yeastgenome.org/cgi-bin/locus.fpl?locus=mbp1 Mbp1] forms heterodimeric complexes with a homologue, [http://www.yeastgenome.org/cgi-bin/locus.fpl?locus=swi6 Swi6]. Swi6 does not have an APSES domain, thus it does not bind DNA. But it is similar to Mbp1 in the region spanning the ankyrin domains and in 1999 [http://www.ncbi.nlm.nih.gov/pubmed/10048928 Foord ''et al.''] published its crystal structure ([http://www.rcsb.org/pdb/cgi/explore.cgi?pdbId=1SW6 1SW6]). This structure is a good model for Ankyrin repeats in Mbp1. For details, please refer to the consolidated [[Reference annotation yeast Mbp1|Mbp1 annotation page]] I have prepared.
 +
 +
In what follows, we will use the program JALVIEW - a Java based multiple sequence alignment editor to load and align sequences and to consider structural similarity between yeast Mbp1 and its closest homologue in your organism.
 +
 +
In this part of the assignment,
 +
 +
#You will load sequences that are most similar to Mbp1 into an MSA editor;
 +
#You will add sequences of ankyrin domain models;
 +
#You will perform a multiple sequence alignment;
 +
#You will try to improve the alignment manually;
 +
<!-- Finally you will consider if the Mbp1 APSES domains could extend beyond the section of homology with Swi6 -->
 +
 +
 +
===Jalview, loading sequences===
 +
 +
 +
Geoff Barton's lab in Dundee has developed an integrated MSA editor and sequence annotation workbench with a number of very useful functions. It is written in Java and should run on Mac, Linux and Windows platforms without modifications.
 +
 +
 +
{{#pmid: 19151095}}
 +
 +
 +
We will use this tool for this assignment and explore its features as we go along.
 +
 +
{{task|1=
 +
#Navigate to the [http://www.jalview.org/ Jalview homepage] click on '''Download''', install Jalview on your computer and start it. A number of windows that showcase the program's abilities will load, you can close these.
 +
#Prepare homologous Mbp1 sequences for alignment:
 +
##Open the '''[[Reference Mbp1 orthologues (all fungi)]]''' page. (This is the list of Mbp1 orthologs I mentioned above.)
 +
##Copy the FASTA sequences of the reference proteins, paste them into a text file (TextEdit on the Mac, Notepad on Windows) and save the file; you could give it an extension of <code>.fa</code>&ndash;but you don't have to.
 +
##Check whether the sequence for YFO is included in the list. If it is, fine. If it is not, retrieve it from NCBI, paste it into the file and edit the header like the other sequences. If the wrong sequence from YFO is included, replace it and let me know.
 +
#Return to Jalview and select File &rarr; Input Alignment &rarr; from File and open your file. A window with sequences should appear.
 +
#Copy the sequences for ankyrin domain models (below), click on the Jalview window, select File &rarr; Add sequences &rarr; from Textbox and paste them into the Jalview textbox. Paste two separate copies of the CD00204 consensus sequence and one copy of 1SW6.
 +
##When all the sequences are present, click on '''Add'''.
 +
 +
Jalview now displays all the sequences, but of course this is not yet an alignment.
 +
 +
}}
 +
 +
;Ankyrin domain models
 +
>CD00204 ankyrin repeat consensus sequence from CDD
 +
NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL
 +
EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHL
 +
 +
>1SW6 from PDB - unstructured loops replaced with xxxx
 +
GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFxxxxSFDSLLQE
 +
VNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKA
 +
VKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGW
 +
IVKKQNRPIQSGxxxxDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALL
 +
DYGADPFIANKSGLRPVDFGAG
 +
 +
===Computing alignments===
 +
 +
The EBI has a very convenient [http://www.ebi.ac.uk/Tools/msa/ page to access a number of MSA algorithms]. This is especially convenient when you want to compare, e.g. T-Coffee and Muscle and MAFFT results to see which regions of your alignment are robust. You could use any of these tools, just paste your sequences into a Webform, download the results and load into Jalview. Easy.
 +
 +
But even easier is to calculate the alignments directly from Jalview.  available. (Not today. <small>Bummer.</small>)
 +
 +
;Calculate a MAFFT alignment using the Jalview Web service option:
 +
 +
{{task|1=
 +
#In Jalview, select '''Web Service &rarr; Alignment &rarr; MAFFT with defaults...'''. The alignment is calculated in a few minutes and displayed in a new window.
 +
}}
 +
 +
;Calculate a MAFFT alignment when the Jalview Web service is NOT available:
 +
 +
{{task|1=
 +
#In Jalview, select '''File &rarr; Output to Textbox &rarr; FASTA'''
 +
#Copy the sequences.
 +
#Navigate to the [http://www.ebi.ac.uk/Tools/msa/mafft/ '''MAFFT Input form'''] at the EBI.
 +
#Paste your sequences into the form.
 +
#Click on '''Submit'''.
 +
#Close the Jalview sequence window and either save your MAFFT alignment to file and load in Jalview, or simply ''''File &rarr; Input Alignment &rarr; from Textbox''', paste and click '''New Window'''.
 +
}}
 +
 +
 +
In any case, you should now have an alignment.
 +
 +
{{task|1=
 +
#Choose '''Colour &rarr; Hydrophobicity''' and '''&rarr; by Conservation'''. Then adjust the slider left or right to see which columns are highly conserved. You will notice that the Swi6 sequence that was supposed to align only to the ankyrin domains was in fact aligned to other parts of the sequence as well. This is one part of the MSA that we will have to correct manually and a common problem when aligning sequences of different lengths.
 +
}}
 +
 +
 +
 +
&nbsp;
 +
 +
===Editing ankyrin domain alignments===
 +
 +
 +
A '''good''' MSA comprises only columns of residues that play similar roles in the proteins' mechanism and/or that evolve in a comparable structural context. Since the alignment reflects the result of biological selection and conservation, it has relatively few indels and the indels it has are usually not placed into elements of secondary structure or into functional motifs. The contiguous features annotated for Mbp1 are expected to be left intact by a good alignment.
 +
 +
A '''poor''' MSA has many errors in its columns; these contain residues that actually have different functions or structural roles, even though they may look similar according to a (pairwise!) scoring matrix. A poor MSA also may have introduced indels in biologically irrelevant positions, to maximize spurious sequence similarities. Some of the features annotated for Mbp1 will be disrupted in a poor alignment and residues that are conserved may be placed into different columns.
 +
 +
Often errors or inconsistencies are easy to spot, and manually editing an MSA is not generally frowned upon, even though this is not a strictly objective procedure. The main goal of manual editing is to make an alignment biologically more plausible. Most comonly this means to mimize the number of rare evolutionary events that the alignment suggests and/or to emphasize conservation of known functional motifs. Here are some examples for what one might aim for in manually editing an alignment:
 +
 +
;Reduce number of indels
 +
From a Probcons alignment:
 +
0447_DEBHA    ILKTE-K<span style="color: rgb(255, 0, 0);">-</span>T<span style="color: rgb(255, 0, 0);">---</span>K--SVVK      ILKTE----KTK---SVVK
 +
9978_GIBZE    MLGLN<span style="color: rgb(255, 0, 0);">-</span>PGLKEIT--HSIT      MLGLNPGLKEIT---HSIT
 +
1513_CANAL    ILKTE-K<span style="color: rgb(255, 0, 0);">-</span>I<span style="color: rgb(255, 0, 0);">---</span>K--NVVK      ILKTE----KIK---NVVK
 +
6132_SCHPO    ELDDI-I<span style="color: rgb(255, 0, 0);">-</span>ESGDY--ENVD      ELDDI-IESGDY---ENVD
 +
1244_ASPFU    ----N<span style="color: rgb(255, 0, 0);">-</span>PGLREIC--HSIT  -&gt;  ----NPGLREIC---HSIT
 +
0925_USTMA    LVKTC<span style="color: rgb(255, 0, 0);">-</span>PALDPHI--TKLK      LVKTCPALDPHI---TKLK
 +
2599_ASPTE    VLDAN<span style="color: rgb(255, 0, 0);">-</span>PGLREIS--HSIT      VLDANPGLREIS---HSIT
 +
9773_DEBHA    LLESTPKQYHQHI--KRIR      LLESTPKQYHQHI--KRIR
 +
0918_CANAL    LLESTPKEYQQYI--KRIR      LLESTPKEYQQYI--KRIR
 +
 +
<small>Gaps marked in red were moved. The sequence similarity in the alignment does not change considerably, however the total number of indels in this excerpt is reduced to 13 from the original 22</small>
 +
 +
 +
;Move indels to more plausible position
 +
From a CLUSTAL alignment:
 +
4966_CANGL    MKHEKVQ------GGYGRFQ---GTW      MKHEKV<span style="color: rgb(0, 170, 0);">Q</span>------GGYGRFQ---GTW
 +
1513_CANAL    KIKNVVK------VGSMNLK---GVW      KIKNVV<span style="color: rgb(0, 170, 0);">K</span>------VGSMNLK---GVW
 +
6132_SCHPO    VDSKHP<span style="color: rgb(255, 0, 0);">-</span>----------<span style="color: rgb(255, 0, 0);">Q</span>ID---GVW  -&gt;  VDSKHP<span style="color: rgb(0, 170, 0);">Q</span>-----------ID---GVW
 +
1244_ASPFU    EICHSIT------GGALAAQ---GYW      EICHSI<span style="color: rgb(0, 170, 0);">T</span>------GGALAAQ---GYW
 +
 +
<small>The two characters marked in red were swapped. This does not change the number of indels but places the "Q" into a a column in which it is more highly conserved (green). Progressive alignments are especially prone to this type of error.</small>
 +
 +
;Conserve motifs
 +
From a CLUSTAL alignment:
 +
6166_SCHPO      --DKR<span style="color: rgb(255, 0, 0);">V</span>A---<span style="color: rgb(255, 0, 0);">G</span>LWVPP      --DKR<span style="color: rgb(0, 255, 0);">V</span>A--<span style="color: rgb(0, 255, 0);">G</span>-LWVPP
 +
XBP1_SACCE      GGYIK<span style="color: rgb(255, 0, 0);">I</span>Q---<span style="color: rgb(255, 0, 0);">G</span>TWLPM      GGYIK<span style="color: rgb(0, 255, 0);">I</span>Q--<span style="color: rgb(0, 255, 0);">G</span>-TWLPM
 +
6355_ASPTE      --DE<span style="color: rgb(255, 0, 0);">I</span>A<span style="color: rgb(255, 0, 0);">G</span>---NVWISP  -&gt;  ---DE<span style="color: rgb(0, 255, 0);">I</span>A--<span style="color: rgb(0, 255, 0);">G</span>NVWISP
 +
5262_KLULA      GGYIK<span style="color: rgb(255, 0, 0);">I</span>Q---<span style="color: rgb(255, 0, 0);">G</span>TWLPY      GGYIK<span style="color: rgb(0, 255, 0);">I</span>Q--<span style="color: rgb(0, 255, 0);">G</span>-TWLPY
 +
 +
<small>The first of the two residues marked in red is a conserved, solvent exposed hydrophobic residue that may mediate domain interactions. The second residue is the conserved glycine in a beta turn that cannot be mutated without structural disruption. Changing the position of a gap and insertion in one sequence improves the conservation of both motifs.</small>
 +
 +
 +
The Ankyrin domains are quite highly diverged, the boundaries not well defined and not even CDD, SMART and SAS agree on the precise annotations. We expect there to be alignment errors in this region. Nevertheless we would hope that a good alignment would recognize homology in that region and that ideally the required <i>indels</i> would be placed between the secondary structure elements, not in their middle. But judging from the sequence alignment alone, we cannot judge where the secondary structure elements ought to be. You should therefore add the following "sequence" to the alignment; it contains exactly as many characters as the Swi6 sequence above and annotates the secondary structure elements. I have derived it from the 1SW6 structure
 +
 +
>SecStruc 1SW6 E: strand  t: turn  H: helix  _: irregular
 +
_EEE__tt___ttt______EE_____t___HHHHHHHHHHHHHHHH_xxxx_HHHHHHH
 +
HHHH_t_____t_____t____HHHHHHH__tHHHHHHHHH____t___tt____HHHHH
 +
HH__HHHH___HHHHHHHHHHHHHEE_t____HHHHHHHHH__t__HHHHHHHHHHHHHH
 +
HHHHHH__EEE_xxxx_HHHHHt_HHHHHHH______t____HHHHHHHH__HHHHHHHH
 +
H____t____t____HHHH___
 +
 +
<div class="reference-box">[http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetPage.pl?pdbcode=1sw6&template=protein.html&r=wiring&l=1&chain=A '''1SW6_A''' at the PDBSum database of structure annotations] You can compare the diagram there with this text string.</div>
 +
 +
 +
To proceed:
 +
#Manually align the Swi6 sequence with yeast Mbp1
 +
#Bring the Secondary structure annotation into its correct alignment with Swi6
 +
#Bring both CDD ankyrin profiles into the correct alignment with yeast Mbp1
 +
 +
Proceed along the following steps:
 +
 +
{{task|1=
 +
#Add the secondary structure annotation to the sequence alignment in Jalview. Copy the annotation, select File &rarr; Add sequences &rarr; from Textbox and paste the sequence.
 +
#Select Help &rarr; Documentation and read about '''Editing Alignments''', '''Cursor Mode''' and '''Key strokes'''.
 +
#Click on the yeast Mbp1 sequence '''row''' to select the entire row. Then use the cursor key to move that sequence down, so it is directly above the 1SW6 sequence. Select the row of 1SW6 and use shift/mouse to move the sequence elements and edit the alignment to match yeast Mbp1. Refer to the alignment given in the [[Reference annotation yeast Mbp1|Mbp1 annotation page]] for the correct alignment.
 +
#Align the secondary structure elements with the 1SW6 sequence: Every character of 1SW6 should be matched with either E, t, H, or _. The result should be similar to the [[Reference annotation yeast Mbp1|Mbp1 annotation page]]. If you need to insert gaps into all sequences in the alignment, simply drag your mouse over all row headers - movement of sequences is constrained to selected regions, the rest is locked into place to prevent inadvertent misalignments. Remember to save your project from time to time: '''File &rarr; save''' so you can reload a previous state if anything goes wrong and can't be fixed with '''Edit &rarr; Undo'''.
 +
#Finally align the two CD00204 consensus sequences to their correct positions (again, refer to the [[Reference annotation yeast Mbp1|Mbp1 annotation page]]).
 +
#You can now consider the principles stated above and see if you can improve the alignment, for example by moving indels out of regions of secondary structure if that is possible without changing the character of the aligned columns significantly. Select blocks within which to work to leave the remaining alignment unchanged. So that this does not become tedious, you can restrict your editing to one Ankyrin repeat that is structurally defined in Swi6. You may want to open the 1SW6 structure in VMD to define the boundaries of one such repeat. You can copy and paste sections from Jalview into your assignment for documentation or export sections of the alignment to HTML (see the example below).
 +
}}
 +
 +
=== Editing ankyrin domain alignments - Sample===
 +
 +
This sample was created by
 +
 +
# Editing the alignments as described above;
 +
# Copying a block of aligned sequence;
 +
# Pasting it To New Alignment;
 +
# Colouring the residues by Hydrophobicity and setting the colour saturation according to Conservation;
 +
# Choosing File &rarr; Export Image &rarr; HTML and pasting the resulting HTML source into this Wikipage.
 +
 +
 +
<table border="1"><tr><td>
 +
<table border="0" cellpadding="0" cellspacing="0">
 +
 +
<tr><td colspan="6"></td>
 +
<td colspan="9">10<br>|</td><td></td>
 +
<td colspan="9">20<br>|</td><td></td>
 +
<td colspan="9">30<br>|</td><td></td>
 +
<td colspan="3"></td><td colspan="3">40<br>|</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_USTMA/341-368&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">E</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#d3c2ee">P</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#ccaddf">T</td>
 +
<td bgcolor="#ecc2d5">M</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1B_SCHCO/470-498&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#f7d8e0">F</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
 +
<td bgcolor="#b0adfa">N</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#fcc2c4">V</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_ASHGO/465-494&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#f4eef8">T</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#efc2d0">C</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#d3c2ee">P</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e5adc6">M</td>
 +
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_CLALU/550-586&nbsp;&nbsp;</td>
 +
<td>G</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td>N</td>
 +
<td>D</td>
 +
<td>K</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>S</td>
 +
<td>K</td>
 +
<td>F</td>
 +
<td>L</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#edadbd">F</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#c6ade5">Y</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f9eef3">M</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBPA_COPCI/514-542&nbsp;&nbsp;</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fdd8da">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#ffadad">I</td>
 +
<td bgcolor="#b0adfa">N</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#fcc2c4">V</td>
 +
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_DEBHA/507-550&nbsp;&nbsp;</td>
 +
<td>I</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td>K</td>
 +
<td>K</td>
 +
 +
<td>L</td>
 +
<td>S</td>
 +
<td>L</td>
 +
<td>S</td>
 +
<td>D</td>
 +
<td>K</td>
 +
<td>K</td>
 +
<td>E</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>A</td>
 +
<td>K</td>
 +
<td>F</td>
 +
<td>I</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#edadbd">F</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
 +
<td bgcolor="#fbadaf">V</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#c6ade5">Y</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1A_SCHCO/388-415&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fdd8da">V</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">E</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#ccaddf">T</td>
 +
<td bgcolor="#ecc2d5">M</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#efc2d0">C</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_AJECA/374-403&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#f9eef3">M</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#faeef2">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PARBR/380-409&nbsp;&nbsp;</td>
 +
<td>I</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#faeef2">C</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_NEOFI/363-392&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#faeef2">C</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#faeef2">C</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#fcc2c4">V</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_ASPNI/365-394&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#faeef2">C</td>
 +
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#fbadaf">V</td>
 +
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#fcc2c4">V</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_UNCRE/377-406&nbsp;&nbsp;</td>
 +
<td>M</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f2d8e5">A</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#faeef2">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PENCH/439-468&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#faeef2">C</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f9eef3">M</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#faeef2">C</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">Q</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#fbadaf">V</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
 +
<td bgcolor="#fcc2c4">V</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBPA_TRIVE/407-436&nbsp;&nbsp;</td>
 +
 +
<td>V</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#e6d8f0">S</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#faeef2">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PHANO/400-429&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#f4eef9">W</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f4eef8">T</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
 +
<td bgcolor="#c5c2fb">Q</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#ffadad">I</td>
 +
<td bgcolor="#e5adc6">M</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_SCLSC/294-313&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#ffadad">I</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_PYRIS/363-392&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#f4eef9">W</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f4eef8">T</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">Q</td>
 +
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#ffadad">I</td>
 +
<td bgcolor="#e5adc6">M</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_/361-390&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>G</td>
 +
<td>V</td>
 +
<td>L</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f7d8e0">F</td>
 +
<td bgcolor="#f3d8e4">M</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
 +
<td bgcolor="#f4eef8">T</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_ASPFL/328-364&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
 +
<td>I</td>
 +
<td>T</td>
 +
<td>L</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f7d8e0">F</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>S</td>
 +
 +
<td>E</td>
 +
<td>I</td>
 +
<td>V</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b0adfa">N</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_MAGOR/375-404&nbsp;&nbsp;</td>
 +
<td>Q</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#fbadaf">V</td>
 +
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#b0adfa">Q</td>
 +
<td bgcolor="#c2c2ff">R</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_CHAGL/361-390&nbsp;&nbsp;</td>
 +
<td>S</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#fbadaf">V</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e5adc6">M</td>
 +
 +
<td bgcolor="#c2c2ff">R</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PODAN/372-401&nbsp;&nbsp;</td>
 +
<td>V</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#fcc2c4">V</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_LACTH/458-487&nbsp;&nbsp;</td>
 +
 +
<td>F</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">Q</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#fbadaf">V</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#b0adfa">Q</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_FILNE/433-460&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fdd8da">V</td>
 +
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#fbeef1">F</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">E</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#ccaddf">T</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_KLULA/477-506&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
 +
<td bgcolor="#f4eef8">T</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#fdeeee">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
 +
<td bgcolor="#d3c2ee">P</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#d5c2ec">Y</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#ccaddf">T</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
 +
<td bgcolor="#eeeefe">D</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_SCHST/468-501&nbsp;&nbsp;</td>
 +
<td>A</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
 +
<td bgcolor="#eeeeff">K</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#ffd8d8">I</td>
 +
 +
<td>A</td>
 +
<td>K</td>
 +
<td>F</td>
 +
<td>I</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
<td bgcolor="#edadbd">F</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#eaadc0">C</td>
 +
 +
<td bgcolor="#caade0">S</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_SACCE/496-525&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
<td bgcolor="#f4eef8">S</td>
 +
 +
<td bgcolor="#f2eefa">P</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#f3eef9">Y</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#eeeefe">E</td>
 +
 +
<td bgcolor="#fdeeef">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
 +
<td bgcolor="#f4eef8">T</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c2c2ff">K</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#ebc2d5">A</td>
 +
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#caade0">S</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">CD00204/1-19&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c5c2fb">E</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#d8d8ff">R</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#d3c2ee">P</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
 +
<td bgcolor="#caade0">S</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#efeefd">H</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">CD00204/99-118&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fdd8da">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
 +
<td bgcolor="#eeeeff">R</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#c2c2ff">K</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
<td bgcolor="#d8d8ff">R</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#d3c2ee">P</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">K</td>
 +
<td bgcolor="#c5c2fb">N</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#efeefd">H</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">1SW6/203-232&nbsp;&nbsp;</td>
 +
<td>L</td>
 +
<td bgcolor="#eeeefe">D</td>
 +
<td bgcolor="#fdeeef">L</td>
 +
<td bgcolor="#eeeeff">K</td>
 +
<td bgcolor="#f4eef9">W</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td bgcolor="#ffeeee">I</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f3d8e4">M</td>
 +
<td bgcolor="#fbd8db">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dad8fd">N</td>
 +
<td bgcolor="#f9eef3">A</td>
 +
<td bgcolor="#eeeefe">Q</td>
 +
<td bgcolor="#c5c2fb">D</td>
 +
<td bgcolor="#d8c2e8">S</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
<td bgcolor="#cfaddc">G</td>
 +
 +
<td bgcolor="#dad8fd">D</td>
 +
<td bgcolor="#d9c2e7">T</td>
 +
<td bgcolor="#efc2d0">C</td>
 +
<td bgcolor="#f7adb3">L</td>
 +
<td bgcolor="#b0adfa">N</td>
 +
<td bgcolor="#ffc2c2">I</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#e4adc7">A</td>
 +
<td bgcolor="#adadff">R</td>
 +
 +
<td bgcolor="#f9c2c7">L</td>
 +
<td bgcolor="#f4eef7">G</td>
 +
<td bgcolor="#eeeefe">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">SecStruc/203-232&nbsp;&nbsp;</td>
 +
<td>t</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#efeefd">H</td>
 +
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td bgcolor="#efeefd">H</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#ead8ed">_</td>
 +
<td bgcolor="#ead8ed">_</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#ead8ed">_</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
 +
<td bgcolor="#dec2e3">_</td>
 +
<td bgcolor="#d9c2e7">t</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
<td bgcolor="#d2add8">_</td>
 +
<td bgcolor="#ead8ed">_</td>
 +
<td bgcolor="#dec2e3">_</td>
 +
<td bgcolor="#c7c2f9">H</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
 +
<td bgcolor="#c7c2f9">H</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#b3adf7">H</td>
 +
<td bgcolor="#c7c2f9">H</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
<td bgcolor="#f5eef6">_</td>
 +
</tr>
 +
</table>
 +
</td></tr>
 +
 +
</table>
 +
;Aligned sequences before editing. The algorithm has placed gaps into the Swi6 helix <code>LKWIIAN</code> and the four-residue gaps before the block of well aligned sequence on the right are poorly supported.
 +
 +
 +
<table border="1"><tr><td>
 +
<table border="0" cellpadding="0" cellspacing="0">
 +
 +
<tr><td colspan="6"></td>
 +
<td colspan="9">10<br>|</td><td></td>
 +
<td colspan="9">20<br>|</td><td></td>
 +
 +
<td colspan="9">30<br>|</td><td></td>
 +
<td colspan="3"></td><td colspan="3">40<br>|</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_USTMA/341-368&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">E</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#c2abe8">P</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#bf99d7">T</td>
 +
<td bgcolor="#e5abc5">M</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1B_SCHCO/470-498&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f2bfcc">F</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#9d99f9">N</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_ASHGO/465-494&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
 +
<td bgcolor="#eaabbf">C</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#c2abe8">P</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#df99b8">M</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_CLALU/550-586&nbsp;&nbsp;</td>
 +
<td>G</td>
 +
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td>K</td>
 +
 +
<td>K</td>
 +
<td>E</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>L</td>
 +
<td>I</td>
 +
<td>S</td>
 +
<td>K</td>
 +
<td bgcolor="#f2bfcc">F</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#e999ad">F</td>
 +
<td bgcolor="#a199f6">H</td>
 +
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#b899df">Y</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#f0d2df">M</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_COPCI/514-542&nbsp;&nbsp;</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#fcbfc1">V</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#ff9999">I</td>
 +
 +
<td bgcolor="#9d99f9">N</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_DEBHA/507-550&nbsp;&nbsp;</td>
 +
<td>I</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td>K</td>
 +
<td>K</td>
 +
<td>L</td>
 +
<td>S</td>
 +
<td>L</td>
 +
<td>S</td>
 +
<td>D</td>
 +
<td>K</td>
 +
 +
<td>K</td>
 +
<td>E</td>
 +
<td>L</td>
 +
<td>I</td>
 +
<td>A</td>
 +
<td>K</td>
 +
<td bgcolor="#f2bfcc">F</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
 +
<td bgcolor="#e999ad">F</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#fb999c">V</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#b899df">Y</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1A_SCHCO/388-415&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fcbfc1">V</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">E</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#bf99d7">T</td>
 +
<td bgcolor="#e5abc5">M</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#eaabbf">C</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
 +
<td bgcolor="#e2d2ee">S</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_AJECA/374-403&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#f0d2df">M</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
<td bgcolor="#afabfa">N</td>
 +
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PARBR/380-409&nbsp;&nbsp;</td>
 +
<td>I</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_NEOFI/363-392&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_ASPNI/365-394&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#caabe0">S</td>
 +
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#fb999c">V</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_UNCRE/377-406&nbsp;&nbsp;</td>
 +
<td>M</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#eabfd3">A</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PENCH/439-468&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
 +
<td bgcolor="#f4d2dc">C</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#f0d2df">M</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">Q</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#fb999c">V</td>
 +
<td bgcolor="#f699a1">L</td>
 +
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_TRIVE/407-436&nbsp;&nbsp;</td>
 +
 +
<td>V</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#d6bfe7">S</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f4d2dc">C</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_PHANO/400-429&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#e2d2ef">W</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">Q</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
 +
<td bgcolor="#ff9999">I</td>
 +
<td bgcolor="#df99b8">M</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_SCLSC/294-313&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#ff9999">I</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBPA_PYRIS/363-392&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#e2d2ef">W</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">Q</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#ff9999">I</td>
 +
<td bgcolor="#df99b8">M</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#afabfa">N</td>
 +
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_/361-390&nbsp;&nbsp;</td>
 +
<td>N</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#f2bfcc">F</td>
 +
<td bgcolor="#ebbfd3">M</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#c399d4">G</td>
 +
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_ASPFL/328-364&nbsp;&nbsp;</td>
 +
<td>T</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td>L</td>
 +
<td>G</td>
 +
<td>R</td>
 +
<td>F</td>
 +
 +
<td>I</td>
 +
<td>S</td>
 +
<td>E</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#fcbfc1">V</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#9d99f9">N</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#c399d4">G</td>
 +
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBPA_MAGOR/375-404&nbsp;&nbsp;</td>
 +
<td>Q</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">N</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#fb999c">V</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9d99f9">Q</td>
 +
<td bgcolor="#ababff">R</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_CHAGL/361-390&nbsp;&nbsp;</td>
 +
<td>S</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#fb999c">V</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#df99b8">M</td>
 +
<td bgcolor="#ababff">R</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_PODAN/372-401&nbsp;&nbsp;</td>
 +
<td>V</td>
 +
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#fcabae">V</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_LACTH/458-487&nbsp;&nbsp;</td>
 +
 +
<td>F</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">Q</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#fb999c">V</td>
 +
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9d99f9">Q</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_FILNE/433-460&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fcbfc1">V</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
 +
<td bgcolor="#f5d2db">F</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">E</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#bf99d7">T</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_KLULA/477-506&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#fcd2d3">V</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#ffbfbf">I</td>
 +
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#caabe0">S</td>
 +
 +
<td bgcolor="#c2abe8">P</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#c5abe5">Y</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#bf99d7">T</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
</tr>
 +
 +
<tr><td nowrap="nowrap">MBP1_SCHST/468-501&nbsp;&nbsp;</td>
 +
<td>A</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>L</td>
 +
<td>I</td>
 +
<td>A</td>
 +
<td>K</td>
 +
<td bgcolor="#f2bfcc">F</td>
 +
 +
<td bgcolor="#ffbfbf">I</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#e999ad">F</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#e699b1">C</td>
 +
<td bgcolor="#be99d9">S</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#afabfa">N</td>
 +
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">MBP1_SACCE/496-525&nbsp;&nbsp;</td>
 +
<td>F</td>
 +
<td bgcolor="#e2d2ee">S</td>
 +
<td bgcolor="#ded2f2">P</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#dfd2f0">Y</td>
 +
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#d4d2fc">E</td>
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#e2d2ed">T</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#ababff">K</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#e3abc6">A</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#ffabab">I</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#be99d9">S</td>
 +
<td bgcolor="#9999ff">K</td>
 +
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">CD00204/1-19&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#afabfa">E</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#bfbfff">R</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#c2abe8">P</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#be99d9">S</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">CD00204/99-118&nbsp;&nbsp;</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#fcbfc1">V</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d2d2ff">R</td>
 +
<td bgcolor="#afabfa">D</td>
 +
<td bgcolor="#ababff">K</td>
 +
 +
<td bgcolor="#d4d2fc">D</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#bfbfff">R</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#c2abe8">P</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">K</td>
 +
<td bgcolor="#afabfa">N</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">1SW6/203-232&nbsp;&nbsp;</td>
 +
<td>L</td>
 +
<td bgcolor="#d4d2fc">D</td>
 +
 +
<td bgcolor="#fbd2d5">L</td>
 +
<td bgcolor="#d2d2ff">K</td>
 +
<td bgcolor="#e2d2ef">W</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#ffd2d2">I</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#ebbfd3">M</td>
 +
<td bgcolor="#f9bfc4">L</td>
 +
<td bgcolor="#c2bffc">N</td>
 +
<td bgcolor="#f0d2e0">A</td>
 +
<td bgcolor="#d4d2fc">Q</td>
 +
<td bgcolor="#afabfa">D</td>
 +
 +
<td bgcolor="#caabe0">S</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
<td bgcolor="#c399d4">G</td>
 +
<td bgcolor="#c2bffc">D</td>
 +
<td bgcolor="#cbabdf">T</td>
 +
<td bgcolor="#eaabbf">C</td>
 +
<td bgcolor="#f699a1">L</td>
 +
<td bgcolor="#9d99f9">N</td>
 +
<td bgcolor="#ffabab">I</td>
 +
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#dd99b9">A</td>
 +
<td bgcolor="#9999ff">R</td>
 +
<td bgcolor="#f7abb2">L</td>
 +
<td bgcolor="#e4d2ec">G</td>
 +
<td bgcolor="#d4d2fc">N</td>
 +
</tr>
 +
<tr><td nowrap="nowrap">SecStruc/203-232&nbsp;&nbsp;</td>
 +
<td>t</td>
 +
 +
<td bgcolor="#e6d2e9">_</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td bgcolor="#d5d2fb">H</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td>-</td>
 +
<td bgcolor="#dcbfe1">_</td>
 +
<td bgcolor="#dcbfe1">_</td>
 +
<td bgcolor="#dcbfe1">_</td>
 +
<td bgcolor="#e6d2e9">_</td>
 +
<td bgcolor="#e6d2e9">_</td>
 +
 +
<td bgcolor="#d2abd8">_</td>
 +
<td bgcolor="#cbabdf">t</td>
 +
<td bgcolor="#e6d2e9">_</td>
 +
<td bgcolor="#c799cf">_</td>
 +
<td bgcolor="#dcbfe1">_</td>
 +
<td bgcolor="#d2abd8">_</td>
 +
<td bgcolor="#b2abf7">H</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#a199f6">H</td>
 +
 +
<td bgcolor="#b2abf7">H</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#a199f6">H</td>
 +
<td bgcolor="#b2abf7">H</td>
 +
<td bgcolor="#e6d2e9">_</td>
 +
<td bgcolor="#e6d2e9">_</td>
 +
</tr>
 +
</table>
 +
</td></tr>
 +
 +
</table>
 +
;Aligned sequence after editing. A significant cleanup of the frayed region is possible. Now there is only one insertion event, and it is placed into the loop that connects two helices of the 1SW6 structure.
 +
 +
 +
===Final analysis===
 +
 +
 +
{{task|1=
 +
* Compare the distribution of indels in the ankyrin repeat regions of your alignments.
 +
**'''Review''' whether the indels in this region are concentrated in segments that connect the helices, or if they are more or less evenly distributed along the entire region of similarity.
 +
**Think about whether the assertion that ''indels should not be placed in elements of secondary structure'' has merit in your alignment.
 +
**Recognize that an indel in an element of secondary structure could be interpreted in a number of different ways:
 +
*** The alignment is correct, the annotation is correct too: the indel is tolerated in that particular case, for example by extending the length of an &alpha;-helix or &beta;-strand;
 +
*** The alignment algorithm has made an error, the structural annotation is correct: the indel should be moved a few residues;
 +
*** The alignment is correct, the structural annotation is wrong, this is not a secondary structure element after all;
 +
*** Both the algorithm and the annotation are probably wrong, but we have no data to improve the situation.
 +
 +
(<small>NB: remember that the structural annotations have been made for the yeast protein and might have turned out differently for the other proteins...</small>)
 +
 +
You should be able to analyse discrepancies between annotation and expectation in a structured and systematic way. In particular if you notice indels that have been placed into an '''annotated''' region of secondary structure, you should be able to comment on whether the location of the indel has strong support from aligned sequence motifs, or whether the indel could possibly be moved into a different location without much loss in alignment quality.
 +
 +
*Considering the whole alignment and your experience with editing, you should be able to state whether the position of indels relative to structural features of the ankyrin domains in your organism's Mbp1 protein is reliable. That would be the result of this task, in which you combine multiple sequence and structural information.
 +
 +
*You can also critically evaluate database information that you have encountered:
 +
# Navigate to the [http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi?INPUT_TYPE=precalc&SEQUENCE=6320147 '''CDD annotation'''] for yeast Mbp1.
 +
# You can check the precise alignment boundaries of the ankyrin domains by clicking on the (+) icon to the left of the matching domain definition.
 +
# Confirm that CDD extends the ankyrin domain annotation beyond the 1SW6 domain boundaries. Given your assessment of conservation in the region beyond the structural annotation:  do you think that extending the annotation is reasonable also in YFO's protein? Is there evidence for this in the alignment of the CD00204 consensus with well aligned blocks of sequence beyond the positions that match Swi6?
 +
}}
 +
 +
==R code: load alignment and compute information scores==
 +
<!-- Add sequence weighting and sampling bias correction ? -->
 +
 +
As discussed in the lecture, Shannon information is calculated as the difference between expected and observed entropy, where entropy is the negative sum over probabilities times the log of those probabilities:
 +
 +
 +
 +
 +
 +
Here we compute Shannon information scores for aligned positions of the APSES domain, and plot the values in '''R'''. You can try this with any part of your alignment, but I have used only the aligned residues for the APSES domain for my example. This is a good choice for a first try, since there are (almost) no gaps.
 +
 +
{{task|1=
 +
# Export only the sequences of the aligned APSES domains to a file on your computer, in FASTA format as explained below. You could call this: <code>Mbp1_All_APSES.fa</code>.
 +
##Use your mouse and clik and drag to ''select'' the aligned APSES domains in the alignment window.
 +
##Copy your selection to the clipboard.
 +
##Use the main menu (not the menu of your alignment window) and select '''File &rarr; Input alignment &rarr; from Textbox'''; paste the selection into the textbox and click '''New Window'''.
 +
##Use '''File &rarr; save as''' to save the aligned siequences in multi-FASTA format under the filename you want in your '''R''' project directory.
 +
 
 +
# Explore the R-code below. Be sure that you understand it correctly. Note that this code does not implement any sampling bias correction, so positions with large numbers of gaps will receive artificially high scores (the alignment looks like the gap charecter were a conserved character).
 +
 +
 +
<source lang="rsplus">
 +
 +
# CalculateInformation.R
 +
# Calculate Shannon information for positions in a multiple sequence alignment.
 +
# Requires: an MSA in multi FASTA format
 +
 +
# It is good practice to set variables you might want to change
 +
# in a header block so you don't need to hunt all over the code
 +
# for strings you need to update.
 +
#
 +
setwd("/your/R/working/directory")
 +
mfa      <- "MBP1_All_APSES.fa"
 +
 +
# ================================================
 +
#    Read sequence alignment fasta file
 +
# ================================================
 +
 +
# read MFA datafile using seqinr function read.fasta()
 +
library(seqinr)
 +
tmp  <- read.alignment(mfa, format="fasta")
 +
MSA  <- as.matrix(tmp)  # convert the list into a characterwise matrix
 +
                        # with appropriate row and column names using
 +
                        # the seqinr function as.matrix.alignment()
 +
                        # You could have a look under the hood of this
 +
                        # function to understand beter how to convert a
 +
                        # list into something else ... simply type
 +
                        # "as.matrix.alignment" - without the parentheses
 +
                        # to retrieve the function source code (as for any
 +
                        # function btw).
 +
 +
### Explore contents of and access to the matrix of sequences
 +
MSA
 +
MSA[1,]
 +
MSA[,1]
 +
length(MSA[,1])
 +
 +
 +
# ================================================
 +
#    define function to calculate entropy
 +
# ================================================
 +
 +
entropy <- function(v) { # calculate shannon entropy for the aa vector v
 +
                    # Note: we are not correcting for small sample sizes
 +
                    # here. Thus if there are a large number of gaps in
 +
                    # the alignment, this will look like small entropy
 +
                    # since only a few amino acids are present. In the
 +
                    # extreme case: if a position is only present in
 +
                    # one sequence, that one amino acid will be treated
 +
                    # as 100% conserved - zero entropy. Sampling error
 +
                    # corrections are discussed eg. in Schneider et al.
 +
                    # (1986) JMB 188:414
 +
l <- length(v)
 +
a <- rep(0, 21)      # initialize a vector with 21 elements (20 aa plus gap)
 +
                    # the set the name of each row to the one letter
 +
                    # code. Through this, we can access a row by its
 +
                    # one letter code.
 +
names(a)  <- unlist(strsplit("acdefghiklmnpqrstvwy-", ""))
 +
 +
for (i in 1:l) {      # for the whole vector of amino acids
 +
c <- v[i]          # retrieve the character
 +
a[c] <- a[c] + 1  # increment its count by one
 +
} # note: we could also have used the table() function for this
 +
 +
tot <- sum(a) - a["-"] # calculate number of observed amino acids
 +
                      # i.e. subtract gaps
 +
a <- a/tot            # frequency is observations of one amino acid
 +
                      # divided by all observations. We assume that
 +
                      # frequency equals probability.
 +
a["-"] <- 0                             
 +
for (i in 1:length(a)) {
 +
if (a[i] != 0) { # if a[i] is not zero, otherwise leave as is.
 +
            # By definition, 0*log(0) = 0  but R calculates
 +
            # this in parts and returns NaN for log(0).
 +
a[i] <- a[i] * (log(a[i])/log(2)) # replace a[i] with
 +
                                  # p(i) log_2(p(i))
 +
}
 +
}
 +
return(-sum(a)) # return Shannon entropy
 +
}
 +
 +
# ================================================
 +
#    calculate entropy for reference distribution
 +
#    (from UniProt, c.f. Assignment 2)
 +
# ================================================
 +
 +
refData <- c(
 +
    "A"=8.26,
 +
    "Q"=3.93,
 +
    "L"=9.66,
 +
    "S"=6.56,
 +
    "R"=5.53,
 +
    "E"=6.75,
 +
    "K"=5.84,
 +
    "T"=5.34,
 +
    "N"=4.06,
 +
    "G"=7.08,
 +
    "M"=2.42,
 +
    "W"=1.08,
 +
    "D"=5.45,
 +
    "H"=2.27,
 +
    "F"=3.86,
 +
    "Y"=2.92,
 +
    "C"=1.37,
 +
    "I"=5.96,
 +
    "P"=4.70,
 +
    "V"=6.87
 +
    )
 +
 +
### Calculate the entropy of this distribution
 +
 +
H.ref <- 0
 +
for (i in 1:length(refData)) {
 +
p <- refData[i]/sum(refData) # convert % to probabilities
 +
    H.ref <- H.ref - (p * (log(p)/log(2)))
 +
}
 +
 +
# ================================================
 +
#    calculate information for each position of
 +
#    multiple sequence alignment
 +
# ================================================
 +
 +
lAli <- dim(MSA)[2] # length of row in matrix is second element of dim(<matrix>).
 +
I <- rep(0, lAli)  # initialize result vector
 +
for (i in 1:lAli) {
 +
I[i] = H.ref - entropy(MSA[,i])  # I = H_ref - H_obs
 +
}
 +
 +
### evaluate I
 +
I
 +
quantile(I)
 +
hist(I)
 +
plot(I)
 +
 +
# you can see that we have quite a large number of columns with the same,
 +
# high value ... what are these?
 +
 +
which(I > 4)
 +
MSA[,which(I > 4)]
 +
 +
# And what is in the columns with low values?
 +
MSA[,which(I < 1.5)]
 +
 +
 +
# ===================================================
 +
#    plot the information
 +
#    (c.f. Assignment 5, see there for explanations)
 +
# ===================================================
 +
 +
IP <- (I-min(I))/(max(I) - min(I) + 0.0001)
 +
nCol <- 15
 +
IP <- floor(IP * nCol) + 1
 +
spect <- colorRampPalette(c("#DD0033", "#00BB66", "#3300DD"), bias=0.6)(nCol)
 +
# lets set the information scores from single informations to grey. We 
 +
# change the highest level of the spectrum to grey.
 +
#spect[nCol] <- "#CCCCCC"
 +
Icol <- vector()
 +
for (i in 1:length(I)) {
 +
Icol[i] <- spect[ IP[i] ]
 +
}
 +
 +
plot(1,1, xlim=c(0, lAli), ylim=c(-0.5, 5) ,
 +
    type="n", bty="n", xlab="position in alignment", ylab="Information (bits)")
 +
 +
# plot as rectangles: height is information and color is coded to information
 +
for (i in 1:lAli) {
 +
  rect(i, 0, i+1, I[i], border=NA, col=Icol[i])
 +
}
 +
 +
# As you can see, some of the columns reach very high values, but they are not
 +
# contiguous in sequence. Are they contiguous in structure? We will find out in
 +
# a later assignment, when we map computed values to structure.
 +
 +
</source>
 +
}}
 +
 +
 +
[[Image:InformationPlot.jpg|frame|none|Plot of information vs. sequence position produced by the '''R''' script above, for an alignment of Mbp1 ortholog APSES domains.]]
 +
 +
 +
 +
&nbsp;
  
 
;That is all.
 
;That is all.

Revision as of 14:34, 2 October 2015

Assignment for Week 4
Sequence alignment

< Assignment 3 Assignment 5 >

Note! This assignment is currently inactive. Major and minor unannounced changes may be made at any time.

 
 

Concepts and activities (and reading, if applicable) for this assignment will be topics on next week's quiz.


 

Introduction

In this assignment we will perform an optimal global and local sequence alignment, and use R to plot the alignment quality as a colored bar-graph.


Optimal sequence alignments

Online programs for optimal sequence alignment are part of the EMBOSS tools. The programs take FASTA files as input.

Local optimal SEQUENCE alignment "water"

Task:

  1. Retrieve the FASTA file for the YFO Mbp1 protein and for Saccharomyces cerevisiae.
  2. Save the files as text files to your computer, (if you haven't done so already). You could give them an extension of .fa.
  3. Access the EMBOSS Explorer site (if you haven't done so yet, you might want to bookmark it.)
  4. Look for ALIGNMENT LOCAL, click on water, paste your FASTA sequences and run the program with default parameters.
  5. Study the results. You will probably find that the alignment extends over most of the protein, but does not include the termini.
  6. Considering the sequence identy cutoff we discussed in class (25% over the length of a domain), do you believe that the APSES domains are homologous?
  7. Change the Gap opening and Gap extension parameters to high values (e.g. 30 and 5). Then run the alignment again.
  8. Note what is different.
  9. You could try getting only an alignment for the ankyrin domains that you have found in the last assignment, by deleting the approximate region of the APSES domains from your input.


Global optimal SEQUENCE alignment "needle"

Task:

  1. Look for ALIGNMENT GLOBAL, click on needle, paste your FASTA sequences and run the program with default parameters.
  2. Study the results. You will find that the alignment extends over the entire protein, likely with long indels at the termini.
  3. Change the Output alignment format to FASTA pairwise simple, to retrieve the aligned FASTA files with indels.
  4. Copy the aligned sequences (with indels) and save them to your computer. You could give them an extension of .fal to remind you that they are aligned FASTA sequences.


 

The Mutation Data Matrix

The NCBI makes its alignment matrices available by ftp. They are located at ftp://ftp.ncbi.nih.gov/blast/matrices - for example here is a link to the BLOSUM62 matrix[1]. Access that site and download the BLOSUM62 matrix to your computer. You could give it a filename of BLOSUM62.mdm.

It should look like this.

#  Matrix made by matblas from blosum62.iij
#  * column uses minimum score
#  BLOSUM Clustered Scoring Matrix in 1/2 Bit Units
#  Blocks Database = /data/blocks_5.0/blocks.dat
#  Cluster Percentage: >= 62
#  Entropy =   0.6979, Expected =  -0.5209
   A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  B  Z  X  *
A  4 -1 -2 -2  0 -1 -1  0 -2 -1 -1 -1 -1 -2 -1  1  0 -3 -2  0 -2 -1  0 -4 
R -1  5  0 -2 -3  1  0 -2  0 -3 -2  2 -1 -3 -2 -1 -1 -3 -2 -3 -1  0 -1 -4 
N -2  0  6  1 -3  0  0  0  1 -3 -3  0 -2 -3 -2  1  0 -4 -2 -3  3  0 -1 -4 
D -2 -2  1  6 -3  0  2 -1 -1 -3 -4 -1 -3 -3 -1  0 -1 -4 -3 -3  4  1 -1 -4 
C  0 -3 -3 -3  9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1 -3 -3 -2 -4 
Q -1  1  0  0 -3  5  2 -2  0 -3 -2  1  0 -3 -1  0 -1 -2 -1 -2  0  3 -1 -4 
E -1  0  0  2 -4  2  5 -2  0 -3 -3  1 -2 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
G  0 -2  0 -1 -3 -2 -2  6 -2 -4 -4 -2 -3 -3 -2  0 -2 -2 -3 -3 -1 -2 -1 -4 
H -2  0  1 -1 -3  0  0 -2  8 -3 -3 -1 -2 -1 -2 -1 -2 -2  2 -3  0  0 -1 -4 
I -1 -3 -3 -3 -1 -3 -3 -4 -3  4  2 -3  1  0 -3 -2 -1 -3 -1  3 -3 -3 -1 -4 
L -1 -2 -3 -4 -1 -2 -3 -4 -3  2  4 -2  2  0 -3 -2 -1 -2 -1  1 -4 -3 -1 -4 
K -1  2  0 -1 -3  1  1 -2 -1 -3 -2  5 -1 -3 -1  0 -1 -3 -2 -2  0  1 -1 -4 
M -1 -1 -2 -3 -1  0 -2 -3 -2  1  2 -1  5  0 -2 -1 -1 -1 -1  1 -3 -1 -1 -4 
F -2 -3 -3 -3 -2 -3 -3 -3 -1  0  0 -3  0  6 -4 -2 -2  1  3 -1 -3 -3 -1 -4 
P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4  7 -1 -1 -4 -3 -2 -2 -1 -2 -4 
S  1 -1  1  0 -1  0  0  0 -1 -2 -2  0 -1 -2 -1  4  1 -3 -2 -2  0  0  0 -4 
T  0 -1  0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1  1  5 -2 -2  0 -1 -1  0 -4 
W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1  1 -4 -3 -2 11  2 -3 -4 -3 -2 -4 
Y -2 -2 -2 -3 -2 -1 -2 -3  2 -1 -1 -2 -1  3 -3 -2 -2  2  7 -1 -3 -2 -1 -4 
V  0 -3 -3 -3 -1 -2 -2 -3 -3  3  1 -2  1 -1 -2 -2  0 -3 -1  4 -3 -2 -1 -4 
B -2 -1  3  4 -3  0  1 -1  0 -3 -4  0 -3 -3 -2  0 -1 -4 -3 -3  4  1 -1 -4 
Z -1  0  0  1 -3  3  4 -2  0 -3 -3  1 -1 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
X  0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2  0  0 -2 -1 -1 -1 -1 -1 -4 
* -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4  1


Task:

  • Study this and make sure you understand what this table is, how it can be used, and what a reasonable range of values for identities and pairscores for non-identical, similar and dissimilar residues is. Ask on the mailing list in case you have questions.


 

The DNA binding site

Now, that you know how YFO Mbp1 aligns with yeast Mbp1, you can evaluate functional conservation in these homologous proteins. You probably already downloaded the two Biochemistry papers by Taylor et al. (2000) and by Deleeuw et al. (2008) that we encountered in Assignment 2. These discuss the residues involved in DNA binding[2]. In particular the residues between 50-74 have been proposed to comprise the DNA recognition domain.

Task:

  1. Using the APSES domain alignment you have just constructed, find the YFO Mbp1 residues that correspond to the range 50-74 in yeast.
  2. Note whether the sequences are especially highly conserved in this region.
  3. Using Chimera, look at the region. Use the sequence window to make sure that the sequence numbering between the paper and the PDB file are the same (they are often not identical!). Then select the residues - the proposed recognition domain - and color them differently for emphasis. Study this in stereo to get a sense of the spatial relationships. Check where the conserved residues are.
  4. A good representation is stick - but other representations that include sidechains will also serve well.
  5. Calculate a solvent accessible surface of the protein in a separate representation and make it transparent.
  6. You could combine three representations: (1) the backbone (in ribbon view), (2) the sidechains of residues that presumably contact DNA, distinctly colored, and (3) a transparent surface of the entire protein. This image should show whether residues annotated as DNA binding form a contiguous binding interface.


DNA binding interfaces are expected to comprise a number of positively charged amino acids, that might form salt-bridges with the phosphate backbone.


Task:

  • Study and consider whether this is the case here and which residues might be included.


 

R code: coloring the alignment by quality

Task:

  • Study this code carefully, execute it, section by section and make sure you understand all of it. Ask on the list if anything is not clear.
# BiostringsExample.R
# Short tutorial on sequence alignment with the Biostrings package.
# Boris Steipe for BCH441, 2013 - 2014
#
setwd("~/path/to/your/R_files/")
setwd("~/Documents/07.TEACHING/37-BCH441 Bioinformatics 2014/05-Materials/Assignment_5 data")

# Biostrings is a package within the bioconductor project.
# bioconducter packages have their own installation system,
# they are normally not installed via CRAN.

# First, you load the BioConductor installer...
source("http://bioconductor.org/biocLite.R")

# Then you can install the Biostrings package and all of its dependencies.
biocLite("Biostrings")

# ... and load the library.
library(Biostrings)

# Some basic (technical) information is available ...
library(help=Biostrings)

# ... but for more in depth documentation, use the
# so called "vignettes" that are provided with every R package.
browseVignettes("Biostrings")

# In this code, we mostly use functions that are discussed in the 
# pairwise alignement vignette.

# Read in two fasta files - you will need to edit this for YFO
sacce <- readAAStringSet("mbp1-sacce.fa", format="fasta")

# "USTMA" is used only as an example here - modify for YFO  :-)
ustma <- readAAStringSet("mbp1-ustma.fa", format="fasta")

sacce
names(sacce) 
names(sacce) <- "Mbp1 SACCE"
names(ustma) <- "Mbp1 USTMA" # Example only ... modify for YFO

width(sacce)
as.character(sacce)

# Biostrings takes a sophisticated approach to sequence alignment ...
?pairwiseAlignment

# ... but the use in practice is quite simple:
ali <- pairwiseAlignment(sacce, ustma, substitutionMatrix = "BLOSUM50")
ali

pattern(ali)
subject(ali)

writePairwiseAlignments(ali)

p <- aligned(pattern(ali))
names(p) <- "Mbp1 SACCE aligned"
s <- aligned(subject(ali))
names(s) <- "Mbp1 USTMA aligned"

# don't overwrite your EMBOSS .fal files
writeXStringSet(p, "mbp1-sacce.R.fal", append=FALSE, format="fasta")
writeXStringSet(s, "mbp1-ustma.R.fal", append=FALSE, format="fasta")

# Done.
  • Compare the alignments you received from the EMBOSS server, and that you co puted using R. Are they aproximately the same? Exactly? You did use different matrices and gap aameters, so minor differences are to be expected. But by and large you should get the same alignments.

We will now use the aligned sequences to compute a graphical display of alignment quality.


Task:

  • Study this code carefully, execute it, section by section and make sure you understand all of it. Ask on the list if anything is not clear.
# aliScore.R
# Evaluating an alignment with a sliding window score
# Boris Steipe, October 2012. Update October 2013
setwd("~/path/to/your/R_files/")

# Scoring matrices can be found at the NCBI. 
# ftp://ftp.ncbi.nih.gov/blast/matrices/BLOSUM62

# It is good practice to set variables you might want to change
# in a header block so you don't need to hunt all over the code
# for strings you need to update.
#
fa1      <- "mbp1-sacce.R.fal"
fa2      <- "mbp1-ustma.R.fal"
code1    <- "SACCE"
code2    <- "USTMA"
mdmFile  <- "BLOSUM62.mdm"
window   <- 9   # window-size (should be an odd integer)

# ================================================
#    Read data files
# ================================================

# read fasta datafiles using seqinr function read.fasta()
install.packages("seqinr")
library(seqinr)
tmp  <- unlist(read.fasta(fa1, seqtype="AA", as.string=FALSE, seqonly=TRUE))
seq1 <- unlist(strsplit(as.character(tmp), split=""))

tmp  <- unlist(read.fasta(fa2, seqtype="AA", as.string=FALSE, seqonly=TRUE))
seq2 <- unlist(strsplit(as.character(tmp), split=""))

if (length(seq1) != length(seq2)) {
	print("Error: Sequences have unequal length!")
	}
	
lSeq <- length(seq1)

# ================================================
#    Read scoring matrix
# ================================================

MDM <- read.table(mdmFile, skip=6)

# This is a dataframe. Study how it can be accessed:

MDM
MDM[1,]
MDM[,1]
MDM[5,5]   # Cys-Cys
MDM[20,20] # Val-Val
MDM[,"W"]  # the tryptophan column
MDM["R","W"]  # Arg-Trp pairscore
MDM["W","R"]  # Trp-Arg pairscore: pairscores are symmetric

colnames(MDM)  # names of columns
rownames(MDM)  # names of rows
colnames(MDM)[3]   # third column
rownames(MDM)[12]  # twelfth row

# change the two "*" names to "-" so we can use them to score
# indels of the alignment. This is a bit of a hack, since this
# does not reflect the actual indel penalties (which is, as you)
# remember from your lectures, calculated as a gap opening
# + gap extension penalty; it can't be calculated in a pairwise
# manner) EMBOSS defaults for BLODSUM62 are opening -10 and
# extension -0.5 i.e. a gap of size 3 (-11.5) has approximately
# the same penalty as a 3-character score of "-" matches (-12)
# so a pairscore of -4 is not entirely unreasonable.

colnames(MDM)[24] 
rownames(MDM)[24]
colnames(MDM)[24] <- "-"
rownames(MDM)[24] <- "-"
colnames(MDM)[24] 
rownames(MDM)[24]
MDM["Q", "-"]
MDM["-", "D"]
# so far so good.

# ================================================
#    Tabulate pairscores for alignment
# ================================================


# It is trivial to create a pairscore vector along the
# length of the aligned sequences.

PS <- vector()
for (i in 1:lSeq) {
   aa1 <- seq1[i] 
   aa2 <- seq2[i] 
   PS[i] = MDM[aa1, aa2]
}

PS


# The same vector could be created - albeit perhaps not so
# easy to understand - with the expression ...
MDM[cbind(seq1,seq2)]



# ================================================
#    Calculate moving averages
# ================================================

# In order to evaluate the alignment, we will calculate a 
# sliding window average over the pairscores. Somewhat surprisingly
# R doesn't (yet) have a native function for moving averages: options
# that are quoted are:
#   - rollmean() in the "zoo" package http://rss.acs.unt.edu/Rdoc/library/zoo/html/rollmean.html
#   - MovingAverages() in "TTR"  http://rss.acs.unt.edu/Rdoc/library/TTR/html/MovingAverages.html
#   - ma() in "forecast"  http://robjhyndman.com/software/forecast/
# But since this is easy to code, we shall implement it ourselves.

PSma <- vector()           # will hold the averages
winS <- floor(window/2)    # span of elements above/below the centre
winC <- winS+1             # centre of the window

# extend the vector PS with zeros (virtual observations) above and below
PS <- c(rep(0, winS), PS , rep(0, winS))

# initialize the window score for the first position
winScore <- sum(PS[1:window])

# write the first score to PSma
PSma[1] <- winScore

# Slide the window along the sequence, and recalculate sum()
# Loop from the next position, to the last position that does not exceed the vector...
for (i in (winC + 1):(lSeq + winS)) { 
   # subtract the value that has just dropped out of the window
   winScore <- winScore - PS[(i-winS-1)] 
   # add the value that has just entered the window
   winScore <- winScore + PS[(i+winS)]  
   # put score into PSma
   PSma[i-winS] <- winScore
}

# convert the sums to averages
PSma <- PSma / window

# have a quick look at the score distributions

boxplot(PSma)
hist(PSma)

# ================================================
#    Plot the alignment scores
# ================================================

# normalize the scores 
PSma <- (PSma-min(PSma))/(max(PSma) - min(PSma) + 0.0001)
# spread the normalized values to a desired range, n
nCol <- 10
PSma <- floor(PSma * nCol) + 1

# Assign a colorspectrum to a vector (with a bit of colormagic,
# don't worry about that for now). Dark colors are poor scores,
# "hot" colors are high scores
spect <- colorRampPalette(c("black", "red", "yellow", "white"), bias=0.4)(nCol)

# Color is an often abused aspect of plotting. One can use color to label
# *quantities* or *qualities*. For the most part, our pairscores measure amino
# acid similarity. That is a quantity and with the spectrum that we just defined
# we associte the measured quantities with the color of a glowing piece
# of metal: we start with black #000000, then first we ramp up the red
# (i.e. low-energy) part of the visible spectrum to red #FF0000, then we
# add and ramp up the green spectrum giving us yellow #FFFF00 and finally we 
# add blue, giving us white #FFFFFF. Let's have a look at the spectrum:

s <- rep(1, nCol)
barplot(s, col=spect, axes=F, main="Color spectrum")

# But one aspect of our data is not quantitatively different: indels.
# We valued indels with pairscores of -4. But indels are not simply poor alignment, 
# rather they are non-alignment. This means stretches of -4 values are really 
# *qualitatively* different. Let's color them differently by changing the lowest 
# level of the spectrum to grey.

spect[1] <- "#CCCCCC"
barplot(s, col=spect, axes=F, main="Color spectrum")

# Now we can display our alignment score vector with colored rectangles.

# Convert the integers in PSma to color values from spect
PScol <- vector()
for (i in 1:length(PSma)) {
	PScol[i] <- spect[ PSma[i] ]  # this is how a value from PSma is used as an index of spect
}

# Plot the scores. The code is similar to the last assignment.
# Create an empty plot window of appropriate size
plot(1,1, xlim=c(-100, lSeq), ylim=c(0, 2) , type="n", yaxt="n", bty="n", xlab="position in alignment", ylab="")

# Add a label to the left
text (-30, 1, adj=1, labels=c(paste("Mbp1:\n", code1, "\nvs.\n", code2)), cex=0.9 )

# Loop over the vector and draw boxes  without border, filled with color.
for (i in 1:lSeq) {
   rect(i, 0.9, i+1, 1.1, border=NA, col=PScol[i])
}

# Note that the numbers along the X-axis are not sequence numbers, but numbers
# of the alignment, i.e. sequence number + indel length. That is important to
# realize: if you would like to add the annotations from the last assignment 
# which I will leave as an exercise, you need to map your sequence numbering
# into alignment numbering. Let me know in case you try that but need some help.


That is all.


 

 

Introduction


 

Take care of things, and they will take care of you.
Shunryu Suzuki


Anyone can click buttons on a Web page, but to use the powerful sequence database search tools right often takes considerable more care, caution and consideration.

Much of what we know about a protein's physiological function is based on the conservation of that function as the species evolves. We assess conservation by comparing sequences between related proteins. Conservation - or its opposite: variation - is a consequence of selection under constraints: protein sequences change as a consequence of DNA mutations, this changes the protein's structure, this in turn changes functions and that has the multiple effects on a species' fitness function. Detrimental variants may be removed. Variation that is tolerated is largely neutral and therefore found only in positions that are neither structurally nor functionally critical. Conservation patterns can thus provide evidence for many different questions: structural conservation among proteins with similar 3D-structures, functional conservation among homologues with comparable roles, or amino acid propensities as predictors for protein engineering and design tasks.

Measuring conservation requires alignment. Therefore a carefully done multiple sequence alignment (MSA) is a cornerstone for the annotation of the essential properties a gene or protein. MSAs are also useful to resolve ambiguities in the precise placement of indels and to ensure that columns in alignments actually contain amino acids that evolve in a similar context. MSAs serve as input for

  • functional annotation;
  • protein homology modeling;
  • phylogenetic analyses, and
  • sensitive homology searches in databases.

In order to perform a multiple sequence alignment, we obviously need a set of homologous sequences. This is where the trouble begins. All interpretation of MSA results depends absolutely on how the input sequences were chosen. Should we include only orthologs, or paralogs as well? Should we include only species with fully sequenced genomes, or can we tolerate that some orthologous genes are possibly missing for a species? Should we include all sequences we can lay our hands on, or should we restrict the selection to a manageable number of representative sequences? All of these choices influence our interpretation:

  • orthologs are expected to be functionally and structurally conserved;
  • paralogs may have divergent function but have similar structure;
  • missing genes may make paralogs look like orthologs; and
  • selection bias may weight our results toward sequences that are over-represented and do not provide a fair representation of evolutionary divergence.


In this assignment, we will set ourselves the task to use PSI-BLAST and find all orthologs and paralogs of the APSES domain containing transcription factors in YFO. We will use these sequences later for multiple alignments, calculation of conservation etc. The methodical problem we will address is: how do we perform a sensitive PSI-BLAST search in one organism. There is an issue to consider:

  • If we restrict the PSI-BLAST search to YFO, PSI-BLAST has little chance of building a meaningful profile - the number of homologues that actually are in YFO is too small. Thus the search will not become very sensitive.
  • If we don't restrict our search, but search in all species, the number of hits may become too large. It becomes increasingly difficult to closely check all hits as to whether they have good coverage, and how will we evaluate the fringe cases of marginal E-value, where we need to decide whether to include a new sequence in the profile, or whether to hold off on it for one or two iterations, to see whether the E-value drops significantly. Profile corruption would make the search useless. This is maybe still manageable if we restrict our search to fungi, but imagine you are working with a bacterial protein, or a protein that is conserved across the entire tree of life: your search will find thousands of sequences. And by next year, thousands more will have been added.

Therefore we have to find a middle ground: add enough species (sequences) to compile a sensitive profile, but not so many that we can no longer individually assess the sequences that contribute to the profile.


Thus in practice, a sensitive PSI-BLAST search needs to address two issues before we begin:

  1. We need to define the sequence we are searching with; and
  2. We need to define the dataset we are searching in.



Defining the sequence to search with

Consider again the task we set out from: find all orthologs and paralogs of the APSES domain containing transcription factors in YFO.


Task:
What query sequence should you use? Should you ...


  1. Search with the full-length Mbp1 sequence from Saccharomyces cerevisiae?
  2. Search with the full-length Mbp1 homolog that you found in YFO?
  3. Search with the structurally defined S. cerevisiae APSES domain sequence?
  4. Search with the APSES domain sequence from the YFO homolog, that you have defined by sequence alignment with the yeast protein?
  5. Search with the KilA-N domain sequence?


Reflect on this (pretend this is a quiz question) and come up with a reasoned answer. Then click on "Expand" to read my opinion on this question.
The full-length Mbp1 sequence from Saccharomyces cerevisiae
Since this sequence contains multiple domains (in particular the ubiquitous Ankyrin domains) it is not suitable for BLAST database searches. You must restrict your search to the domain of greatest interest for your question. That would be the APSES domain.
The full-length Mbp1 homolog that you found in YFO
What organism the search sequence comes from does not make a difference. Since you aim to find all homologs in YFO, it is not necessary to have your search sequence more or less similar to any particular homologs. In fact any APSES sequence should give you the same result, since they are all homologous. But the full-length sequence in YFO has the same problem as the Saccharomyces sequence.
The structurally defined S. cerevisiae APSES domain sequence?
That would be my first choice, just because it is structurally well defined as a complete domain, and the sequence is easy to obtain from the 1BM8 PDB entry. (1MB1 would also work, but you would need to edit out the penta-Histidine tag at the C-terminus that was engineered into the sequence to help purify the recombinantly expressed protein.)
The APSES domain sequence from the YFO homolog, that you have defined by sequence alignment with the yeast protein?
As argued above: since they are all homologs, any of them should lead to the same set of results.
The KilA-N domain sequence?
This is a shorter sequence and a more distant homolog to the domain we are interested in. It would not be my first choice: the fact that it is more distantly related might make the search more sensitive. The fact that it is shorter might make the search less specific. The effect of this tradeoff would need to be compared and considered. By the way: the same holds for the even shorter subdomain 50-74 we discussed in the last assignment. However: one of the results of our analysis will be whether APSES domains in fungi all have the same length as the Mbp1 domain, or whether some are indeed much shorter, as suggested by the Pfam alignment.


So in my opinion, you should search with the yeast Mbp1 APSES domain, i.e. the sequence which you have previously studied in the crystal structure. Where is that? Well, you might have saved it in your journal, or you can get it again from the PDB (i.e. here, or from Assignment 3.

 

Selecting species for a PSI-BLAST search

As discussed in the introduction, in order to use our sequence set for studying structural and functional features and conservation patterns of our APSES domain proteins, we should start with a well selected dataset of APSES domain containing homologs in YFO. Since these may be quite divergent, we can't rely on BLAST to find all of them, we need to use the much more sensitive search of PSI-BLAST instead. But even though you are interested only in YFO's genes, it would be a mistake to restrict the PSI-BLAST search to YFO. PSI-BLAST becomes more sensitive if the profile represents more diverged homologs. Therefore we should always search with a broadly representative set of species, even if we are interested only in the results for one of the species. This is important. Please reflect on this for a bit and make sure you understand the rationale why we include sequences in the search that we are not actually interested in.


But you can also search with too many species: if the number of species is large and PSI-BLAST finds a large number of results:

  1. it becomes unwieldy to check the newly included sequences at each iteration, inclusion of false-positive hits may result, profile corruption and loss of specificity. The search will fail.
  2. since genomes from some parts of the Tree Of Life are over represented, the inclusion of all sequences leads to selection bias and loss of sensitivity.


We should therefore try to find a subset of species

  1. that represent as large a range as possible on the evolutionary tree;
  2. that are as well distributed as possible on the tree; and
  3. whose genomes are fully sequenced.

These criteria are important. Again, reflect on them and understand their justification. Choosing your species well for a PSI-BLAST search can be crucial to obtain results that are robust and meaningful.

How can we define a list of such species, and how can we use the list?

The definition is a rather typical bioinformatics task for integrating datasources: "retrieve a list of representative fungi with fully sequenced genomes". Unfortunately, to do this in a principled way requires tools that you can't (yet) program: we would need to use a list of genome sequenced fungi, estimate their evolutionary distance and select a well-distributed sample. Regrettably you can't combine such information easily with the resources available from the NCBI.

We will use an approach that is conceptually similar: selecting a set of species according to their shared taxonomic rank in the tree of life. Biological classification provides a hierarchical system that describes evolutionary relatedness for all living entities. The levels of this hierarchy are so called taxonomic ranks. These ranks are defined in Codes of Nomenclature that are curated by the self-governed international associations of scientists working in the field. The number of ranks is not specified: there is a general consensus on seven principal ranks (see below, in bold) but many subcategories exist and may be newly introduced. It is desired–but not mandated–that ranks represent clades (a group of related species, or a "branch" of a phylogeny), and it is desired–but not madated–that the rank is sharply defined. The system is based on subjective dissimilarity. Needless to say that it is in flux.

If we follow a link to an entry in the NCBI's Taxonomy database, eg. Saccharomyces cerevisiae S228c, the strain from which the original "yeast genome" was sequenced in the late 1990s, we see the following specification of its taxonomic lineage:


cellular organisms; Eukaryota; Opisthokonta; Fungi; Dikarya; 
Ascomycota; Saccharomyceta; Saccharomycotina; Saccharomycetes; 
Saccharomycetales; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae


These names can be mapped into taxonomic ranks ranks, since the suffixes of these names e.g. -mycotina, -mycetaceae are specific to defined ranks. (NCBI does not provide this mapping, but Wikipedia is helpful here.)

Rank Suffix Example
Domain Eukaryota (Eukarya)
  Subdomain   Opisthokonta
Kingdom   Fungi
  Subkingdom   Dikarya
Phylum   Ascomycota
  rankless taxon[3] -myceta Saccharomyceta
  Subphylum -mycotina Saccharomycotina
Class -mycetes Saccharomycetes
  Subclass -mycetidae  
Order -ales Saccharomycetales
Family -aceae Saccharomycetaceae
  Subfamily -oideae  
  Tribe -eae  
  Subtribe -ineae  
Genus   Saccharomyces
Species   Saccharomyces cerevisiae
You can see that there is not a common mapping between the yeast lineage and the commonly recognized categories - not all ranks are represented. Nor is this consistent across species in the taxonomic database: some have subfamily ranks and some don't. And the tree is in no way normalized - some of the ranks have thousands of members, and for some, only a single extant member may be known, or it may be a rank that only relates to the fossil record. But the ranks do provide some guidance to evolutionary divergence. Say you want to choose four species across the tree of life for a study, you should choose one from each of the major domains of life: Eubacteria, Euryarchaeota, Crenarchaeota-Eocytes, and Eukaryotes. Or you want to study a gene that is specific to mammals. Then you could choose from the clades listed in the NCBI taxonomy database under Mammalia (a class rank, and depending how many species you would want to include, use the subclass-, order-, or family rank (hover over the names to see their taxonomic rank.) There will still be quite a bit of manual work involved and an exploration of different options on the Web may be useful. For our purposes here we can retrieve a good set of organisms from the ensembl fungal genomes page - maintained by the EBI's genome annotation group - that lists species grouped by taxonomic order. All of these organisms are genome-sequenced, we can pick a set of representatives:
  1. Capnodiales   Zymoseptoria tritici
  2. Erysiphales   Blumeria graminis
  3. Eurotiales   Aspergillus nidulans
  4. Glomerellales   Glomerella graminicola
  5. Hypocreales   Trichoderma reesei
  6. Magnaporthales   Magnaporthe oryzae
  7. Microbotryales   Microbotryum violaceum
  8. Pezizales   Tuber melanosporum
  9. Pleosporales   Phaeosphaeria nodorum
  10. Pucciniales   Puccinia graminis
  11. Saccharomycetales   Saccharomyces cerevisiae
  12. Schizosaccharomycetales   Schizosaccharomyces pombe
  13. Sclerotiniaceae   Sclerotinia sclerotiorum
  14. Sordariales   Neurospora crassa
  15. Tremellales   Cryptococcus neoformans
  16. Ustilaginales   Ustilago maydis
This set of organisms thus can be used to generate a PSI-BLAST search in a well-distributed set of species. Of course you must also include YFO (if YFO is not in this list already). To enter these 16 species as an Entrez restriction, they need to be formatted as below. (One could also enter species one by one, by pressing the (+) button after the organism list)
Aspergillus nidulans[orgn]
OR Blumeria graminis[orgn]
OR Cryptococcus neoformans[orgn]
OR Glomerella graminicola[orgn]
OR Magnaporthe oryzae[orgn]
OR Microbotryum violaceum[orgn] 
OR Neurospora crassa[orgn]
OR Phaeosphaeria nodorum[orgn]
OR Puccinia graminis[orgn]
OR Sclerotinia sclerotiorum[orgn]
OR Trichoderma reesei[orgn]
OR Tuber melanosporum[orgn]
OR Saccharomyces cerevisiae[orgn]
OR Schizosaccharomyces pombe[orgn]
OR Ustilago maydis[orgn]
OR Zymoseptoria tritici[orgn]


 

Executing the PSI-BLAST search

We have a list of species. Good. Next up: how do we use it.

Task:

  1. Navigate to the BLAST homepage.
  2. Select protein BLAST.
  3. Paste the APSES domain sequence into the search field.
  4. Select refseq as the database.
  5. Copy the organism restriction list from above and enter the correct name for YFO into the list if it is not there already. Obviously, you can't find sequences in YFO if YFO is not included in your search space. Paste the list into the Entrez Query field.
  6. In the Algorithm section, select PSI-BLAST.
  7. Click on BLAST.


Evaluate the results carefully. Since we used default parameters, the threshold for inclusion was set at an E-value of 0.005 by default, and that may be a bit too lenient. If you look at the table of your hits– in the Sequences producing significant alignments... section– there may also be a few sequences that have a low query coverage of less than 80%. Let's exclude these from the profile initially: not to worry, if they are true positives, the will come back with improved E-values and greater coverage in subsequent iterations. But if they were false positives, their E-values will rise and they should drop out of the profile and not contaminate it.


Task:

  1. In the header section, click on Formatting options and in the line "Format for..." set the with inclusion threshold to 0.001 (This means E-values can't be above 10-03 for the sequence to be included.)
  2. Click on the Reformat button (top right).
  3. In the table of sequence descriptions (not alignments!), click on the Query coverage to sort the table by coverage, not by score.
  4. Copy the rows with a coverage of less than 80% and paste them into some text editor so you can compare what happens with these sequences in the next iteration.
  5. Deselect the check mark next to these sequences in the right-hand column Select for PSI blast. (For me these are six sequences, but with YFO included that may be a bit different.)
  6. Then scroll to Run PSI-BLAST iteration 2 ... and click on Go.


This is now the "real" PSI-BLAST at work: it constructs a profile from all the full-length sequences and searches with the profile, not with any individual sequence. Note that we are controlling what goes into the profile in two ways:

  1. we are explicitly removing sequences with poor coverage; and
  2. we are requiring a more stringent minimum E-value for each sequence.


Task:

  1. Again, study the table of hits. Sequences highlighted in yellow have met the search criteria in the second iteration. Note that the coverage of (some) of the previously excluded sequences is now above 80%.
  2. Let's exclude partial matches one more time. Again, deselect all sequences with less than 80% coverage. Then run the third iteration.
  3. Iterate the search in this way until no more "New" sequences are added to the profile. Then scan the list of excluded hits ... are there any from YFO that seem like they could potentially make the list? Marginal E-value perhaps, or reasonable E-value but less coverage? If that's the case, try returning the E-value threshold to the default 0.005 and see what happens...


Once no "new" sequences have been added, if we were to repeat the process again and again, we would always get the same result because the profile stays the same. We say that the search has converged. Good. Time to harvest.


Task:

  1. At the header, click on Taxonomy reports and find YFO in the Organism Report section. These are your APSES domain homologs. All of them. Actually, perhaps more than all: the report may also include sequences with E-values above the inclusion threshold.
  2. From the report copy the sequence identifiers
    1. from YFO,
    2. with E-values above your defined threshold.

For example, the list of Saccharomyces genes is the following:

Saccharomyces cerevisiae S288c [ascomycetes] taxid 559292
ref|NP_010227.1| Mbp1p [Saccharomyces cerevisiae S288c] [ 131] 1e-38
ref|NP_011036.1| Swi4p [Saccharomyces cerevisiae S288c] [ 123] 1e-35
ref|NP_012881.1| Phd1p [Saccharomyces cerevisiae S288c] [ 91] 1e-25
ref|NP_013729.1| Sok2p [Saccharomyces cerevisiae S288c] [ 93] 3e-25
ref|NP_012165.1| Xbp1p [Saccharomyces cerevisiae S288c] [ 40] 5e-07

Xbp1 is a special case. It has only very low coverage, but that is because it has a long domain insertion and the N-terminal match often is not recognized by alignment because the gap scores for long indels are unrealistically large. For now, I keep that sequence with the others.


Next we need to retrieve the sequences. Tedious to retrieve them one by one, but we can get them all at the same time:


Task:

  1. Return to the BLAST results page and again open the Formatting options.
  2. Find the Limit results section and enter YFO's name into the field. For example Saccharomyces cerevisiae [ORGN]
  3. Click on Reformat
  4. Scroll to the Descriptions section, check the box at the left-hand margin, next to each sequence you want to keep. Then click on Download → FASTA complete sequence → Continue.


There are actually several ways to download lists of sequences. Using the results page utility is only one. But if you know the GIs of the sequences you need, you can get them more directly by putting them into the URL...

Even more flexible is the eUtils interface to the NCBI databases. For example you can download the dataset in text format by clicking below.

Note that this utility does not show anything, but downloads the (multi) fasta file to your default download directory.


Introduction

In the last assignment we discovered homologs to S. cerevisiae Mbp1 in YFO. Some of these will be orthologs to Mbp1, some will be paralogs. Some will have similar function, some will not. We discussed previously that genes that evolve under continuously similar evolutionary pressure should be most similar in sequence, and should have the most similar "function".

In this assignment we will define the YFO gene that is the most similar ortholog to S. cerevisiae Mbp1, and perform a multiple sequence alignment with it.

Let us briefly review the basic concepts.

Orthologs and Paralogs revisited

 

All related genes are homologs.


Two central definitions about the mutual relationships between related genes go back to Walter Fitch who stated them in the 1970s:

 

Orthologs have diverged after speciation.
Paralogs have diverged after duplication.


 


Hypothetical evolutionary tree. A single gene evolves through two speciation events and one duplication event. A duplication occurs during the evolution from reptilian to synapsid. It is easy to see how this pair of genes (paralogs) in the ancestral synapsid gives rise to two pairs of genes in pig and elephant, respectively. All circle genes are mutually orthologs, they form a "cluster of orthologs". All genes within one species are mutual paralogs–they are so called in-paralogs. The circle gene in pig and the triangle gene in the elephant are so-called out-paralogs. Somewhat counterintuitively, the triangle gene in the pig and the circle gene in the raven are also orthologs - but this has to be, since the last common ancestor diverged by speciation. The "phylogram" on the right symbolizes the amount of evolutionary change as proportional to height difference to the "root". It is easy to see how a bidirectional BLAST search will only find pairs of most similar orthologs. If applied to a group of species, bidirectional BLAST searches will find clusters of orthologs only (except if genes were lost, or there are anomalies in the evolutionary rate.)


Defining orthologs

To be reasonably certain about orthology relationships, we would need to construct and analyze detailed evolutionary trees. This is computationally expensive and the results are not always unambiguous either, as we will see in a later assignment. But a number of different strategies are available that use precomputed results to define orthologs. These are especially useful for large, cross genome surveys. They are less useful for detailed analysis of individual genes. Pay the sites a visit and try a search.


Orthologs by eggNOG
The eggNOG (evolutionary genealogy of genes: Non-supervised Orthologous Groups) database contains orthologous groups of genes at the EMBL. It seems to be continuously updtaed, the search functionality is reasonable and the results for yeast Mbp1 show many genes from several fungi. Importantly, there is only one gene annotated for each species. Alignments and trees are also available, as are database downloads for algorithmic analysis.

 

Powell et al. (2014) eggNOG v4.0: nested orthology inference across 3686 organisms. Nucleic Acids Res 42:D231-9. (pmid: 24297252)

PubMed ] [ DOI ] With the increasing availability of various 'omics data, high-quality orthology assignment is crucial for evolutionary and functional genomics studies. We here present the fourth version of the eggNOG database (available at http://eggnog.embl.de) that derives nonsupervised orthologous groups (NOGs) from complete genomes, and then applies a comprehensive characterization and analysis pipeline to the resulting gene families. Compared with the previous version, we have more than tripled the underlying species set to cover 3686 organisms, keeping track with genome project completions while prioritizing the inclusion of high-quality genomes to minimize error propagation from incomplete proteome sets. Major technological advances include (i) a robust and scalable procedure for the identification and inclusion of high-quality genomes, (ii) provision of orthologous groups for 107 different taxonomic levels compared with 41 in eggNOGv3, (iii) identification and annotation of particularly closely related orthologous groups, facilitating analysis of related gene families, (iv) improvements of the clustering and functional annotation approach, (v) adoption of a revised tree building procedure based on the multiple alignments generated during the process and (vi) implementation of quality control procedures throughout the entire pipeline. As in previous versions, eggNOGv4 provides multiple sequence alignments and maximum-likelihood trees, as well as broad functional annotation. Users can access the complete database of orthologous groups via a web interface, as well as through bulk download.


Orthologs at OrthoDB
OrthoDB includes a large number of species, among them all of our protein-sequenced fungi. However the search function (by keyword) retrieves many paralogs together with the orthologs, for example, the yeast Soc2 and Phd1 proteins are found in the same orthologous group these two are clearly paralogs.

 

Waterhouse et al. (2013) OrthoDB: a hierarchical catalog of animal, fungal and bacterial orthologs. Nucleic Acids Res 41:D358-65. (pmid: 23180791)

PubMed ] [ DOI ] The concept of orthology provides a foundation for formulating hypotheses on gene and genome evolution, and thus forms the cornerstone of comparative genomics, phylogenomics and metagenomics. We present the update of OrthoDB-the hierarchical catalog of orthologs (http://www.orthodb.org). From its conception, OrthoDB promoted delineation of orthologs at varying resolution by explicitly referring to the hierarchy of species radiations, now also adopted by other resources. The current release provides comprehensive coverage of animals and fungi representing 252 eukaryotic species, and is now extended to prokaryotes with the inclusion of 1115 bacteria. Functional annotations of orthologous groups are provided through mapping to InterPro, GO, OMIM and model organism phenotypes, with cross-references to major resources including UniProt, NCBI and FlyBase. Uniquely, OrthoDB provides computed evolutionary traits of orthologs, such as gene duplicability and loss profiles, divergence rates, sibling groups, and now extended with exon-intron architectures, syntenic orthologs and parent-child trees. The interactive web interface allows navigation along the species phylogenies, complex queries with various identifiers, annotation keywords and phrases, as well as with gene copy-number profiles and sequence homology searches. With the explosive growth of available data, OrthoDB also provides mapping of newly sequenced genomes and transcriptomes to the current orthologous groups.


Orthologs at OMA

OMA (the Orthologous Matrix) maintained at the Swiss Federal Institute of Technology contains a large number of orthologs from sequenced genomes. Searching with MBP1_YEAST (this is the Swissprot ID) as a "Group" search finds the correct gene in EREGO, KLULA, CANGL and SACCE. But searching with the sequence of the Ustilago maydis ortholog does not find the yeast protein, but the orthologs in YARLI, SCHPO, LACCBI, CRYNE and USTMA. Apparently the orthologous group has been split into several subgroups across the fungi. However as a whole the database is carefully constructed and available for download and API access; a large and useful resource.

 

Altenhoff et al. (2011) OMA 2011: orthology inference among 1000 complete genomes. Nucleic Acids Res 39:D289-94. (pmid: 21113020)

PubMed ] [ DOI ] OMA (Orthologous MAtrix) is a database that identifies orthologs among publicly available, complete genomes. Initiated in 2004, the project is at its 11th release. It now includes 1000 genomes, making it one of the largest resources of its kind. Here, we describe recent developments in terms of species covered; the algorithmic pipeline--in particular regarding the treatment of alternative splicing, and new features of the web (OMA Browser) and programming interface (SOAP API). In the second part, we review the various representations provided by OMA and their typical applications. The database is publicly accessible at http://omabrowser.org.

... see also the related articles, much innovative and carefully done work on automated orthologue definition by the Dessimoz group.


Orthologs by syntenic gene order conservation
We will revisit this when we explore the UCSC genome browser.


Orthologs by RBM
Defining it yourself. RBM (or: Reciprocal Best Match) is easy to compute and half of the work you have already done in Assignment 3. Get the ID for the gene which you have identified and annotated as the best BLAST match for Mbp1 in YFO and confirm that this gene has Mbp1 as the most significant hit in the yeast proteome. The results are unambiguous, but there may be residual doubt whether these two best-matching sequences are actually the most similar orthologs.

Task:

  1. Navigate to the BLAST homepage.
  2. Paste the YFO RefSeq sequence identifier into the search field. (You don't have to search with sequences–you can search directly with an NCBI identifier IF you want to search with the full-length sequence.)
  3. Set the database to refseq, and restrict the species to Saccharomyces cerevisiae.
  4. Run BLAST.
  5. Keep the window open for the next task.

The top hit should be yeast Mbp1 (NP_010227). E mail me your sequence identifiers if it is not. If it is, you have confirmed the RBM or BBM criterion (Reciprocal Best Match or Bidirectional Best Hit, respectively).

Technically, this is not perfectly true since you have searched with the APSES domain in one direction, with the full-length sequence in the other. For this task I wanted you to try the search-with-accession-number. Therefore the procedural laxness, I hope it is permissible. In fact, performing the reverse search with the YFO APSES domain should actually be more stringent, i.e. if you find the right gene with the longer sequence, you are even more likely to find the right gene with the shorter one.


Orthology by annotation
The NCBI precomputes BLAST results and makes them available at the RefSeq database entry for your protein.

Task:

  1. In your BLAST result page, click on the RefSeq link for your query to navigate to the RefSeq database entry for your protein.
  2. Follow the Blink link in the right-hand column under Related information.
  3. Restrict the view RefSeq under the "Display options" and to Fungi.

You should see a number of genes with low E-values and high coverage in other fungi - however this search is problematic since the full length gene across the database finds mostly Ankyrin domains.


You will find that all of these approaches yield some of the orthologs. But none finds them all. The take home message is: precomputed results are good for large-scale survey-type investigations, where you can't humanly process the information by hand. But for more detailed questions, careful manual searches are still indsipensable.

Orthology by crowdsourcing
Luckily a crowd of willing hands has prepared the necessary sequences for you: in the section below you will find a link to the annotated and verified Mbp1 orthologs from last year's course :-)

We could call this annotation by many hands "crowdsourcing" - handing out small parcels of work to many workers, who would typically allocate only a small share of their time, but here the strength is in numbers and especially projects that organize via the Internet can tally up very impressive manpower, for free, or as Microwork. These developments have some interest for bioinformatics: many of our more difficult tasks can not be easily built into an algorithm, language related tasks such as text-mining, or pattern matching tasks come to mind. Allocating this to a large number of human contributors may be a viable alternative to computation. A marketplace where this kind of work is already a reality is Amazon's "Mechanical Turk" Marketplace: programmers–"requesters"– use an open interface to post tasks for payment, "providers" from all over the world can engage in these. Tasks may include matching of pictures, or evaluating the aesthetics of competing designs. A quirky example I came across recently was when information designer David McCandless had 200 "Mechanical Turks" draw a small picture of their soul for his collection.

The name "Mechanical Turk" by the way relates to a famous ruse, when a Hungarian inventor and adventurer toured the imperial courts of 18th century Europe with an automaton, dressed in turkish robes and turban, that played chess at the grandmaster level against opponents that included Napoleon Bonaparte and Benjamin Franklin. No small mechanical feat in any case, it was only in the 19th century that it was revealed that the computational power was actually provided by a concealed human.

Are you up for some "Turking"? Before the next quiz, edit the Mbp1 RBM page on the Student Wiki and include the RBM for Mbp1, for a 10% bonus on the next quiz.


 

Align and Annotate

 


Review of domain annotations

APSES domains are relatively easy to identify and annotate but we have had problems with the ankyrin domains in Mbp1 homologues. Both CDD as well as SMART have identified such domains, but while the domain model was based on the same Pfam profile for both, and both annotated approximately the same regions, the details of the alignments and the extent of the predicted region was different.

Mbp1 forms heterodimeric complexes with a homologue, Swi6. Swi6 does not have an APSES domain, thus it does not bind DNA. But it is similar to Mbp1 in the region spanning the ankyrin domains and in 1999 Foord et al. published its crystal structure (1SW6). This structure is a good model for Ankyrin repeats in Mbp1. For details, please refer to the consolidated Mbp1 annotation page I have prepared.

In what follows, we will use the program JALVIEW - a Java based multiple sequence alignment editor to load and align sequences and to consider structural similarity between yeast Mbp1 and its closest homologue in your organism.

In this part of the assignment,

  1. You will load sequences that are most similar to Mbp1 into an MSA editor;
  2. You will add sequences of ankyrin domain models;
  3. You will perform a multiple sequence alignment;
  4. You will try to improve the alignment manually;


Jalview, loading sequences

Geoff Barton's lab in Dundee has developed an integrated MSA editor and sequence annotation workbench with a number of very useful functions. It is written in Java and should run on Mac, Linux and Windows platforms without modifications.


Waterhouse et al. (2009) Jalview Version 2--a multiple sequence alignment editor and analysis workbench. Bioinformatics 25:1189-91. (pmid: 19151095)

PubMed ] [ DOI ] UNLABELLED: Jalview Version 2 is a system for interactive WYSIWYG editing, analysis and annotation of multiple sequence alignments. Core features include keyboard and mouse-based editing, multiple views and alignment overviews, and linked structure display with Jmol. Jalview 2 is available in two forms: a lightweight Java applet for use in web applications, and a powerful desktop application that employs web services for sequence alignment, secondary structure prediction and the retrieval of alignments, sequences, annotation and structures from public databases and any DAS 1.53 compliant sequence or annotation server. AVAILABILITY: The Jalview 2 Desktop application and JalviewLite applet are made freely available under the GPL, and can be downloaded from www.jalview.org.


We will use this tool for this assignment and explore its features as we go along.

Task:

  1. Navigate to the Jalview homepage click on Download, install Jalview on your computer and start it. A number of windows that showcase the program's abilities will load, you can close these.
  2. Prepare homologous Mbp1 sequences for alignment:
    1. Open the Reference Mbp1 orthologues (all fungi) page. (This is the list of Mbp1 orthologs I mentioned above.)
    2. Copy the FASTA sequences of the reference proteins, paste them into a text file (TextEdit on the Mac, Notepad on Windows) and save the file; you could give it an extension of .fa–but you don't have to.
    3. Check whether the sequence for YFO is included in the list. If it is, fine. If it is not, retrieve it from NCBI, paste it into the file and edit the header like the other sequences. If the wrong sequence from YFO is included, replace it and let me know.
  3. Return to Jalview and select File → Input Alignment → from File and open your file. A window with sequences should appear.
  4. Copy the sequences for ankyrin domain models (below), click on the Jalview window, select File → Add sequences → from Textbox and paste them into the Jalview textbox. Paste two separate copies of the CD00204 consensus sequence and one copy of 1SW6.
    1. When all the sequences are present, click on Add.

Jalview now displays all the sequences, but of course this is not yet an alignment.

Ankyrin domain models
>CD00204 ankyrin repeat consensus sequence from CDD
NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL
EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHL
>1SW6 from PDB - unstructured loops replaced with xxxx
GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFxxxxSFDSLLQE
VNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKA
VKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGW
IVKKQNRPIQSGxxxxDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALL
DYGADPFIANKSGLRPVDFGAG

Computing alignments

The EBI has a very convenient page to access a number of MSA algorithms. This is especially convenient when you want to compare, e.g. T-Coffee and Muscle and MAFFT results to see which regions of your alignment are robust. You could use any of these tools, just paste your sequences into a Webform, download the results and load into Jalview. Easy.

But even easier is to calculate the alignments directly from Jalview. available. (Not today. Bummer.)

Calculate a MAFFT alignment using the Jalview Web service option

Task:

  1. In Jalview, select Web Service → Alignment → MAFFT with defaults.... The alignment is calculated in a few minutes and displayed in a new window.
Calculate a MAFFT alignment when the Jalview Web service is NOT available

Task:

  1. In Jalview, select File → Output to Textbox → FASTA
  2. Copy the sequences.
  3. Navigate to the MAFFT Input form at the EBI.
  4. Paste your sequences into the form.
  5. Click on Submit.
  6. Close the Jalview sequence window and either save your MAFFT alignment to file and load in Jalview, or simply 'File → Input Alignment → from Textbox, paste and click New Window.


In any case, you should now have an alignment.

Task:

  1. Choose Colour → Hydrophobicity and → by Conservation. Then adjust the slider left or right to see which columns are highly conserved. You will notice that the Swi6 sequence that was supposed to align only to the ankyrin domains was in fact aligned to other parts of the sequence as well. This is one part of the MSA that we will have to correct manually and a common problem when aligning sequences of different lengths.


 

Editing ankyrin domain alignments

A good MSA comprises only columns of residues that play similar roles in the proteins' mechanism and/or that evolve in a comparable structural context. Since the alignment reflects the result of biological selection and conservation, it has relatively few indels and the indels it has are usually not placed into elements of secondary structure or into functional motifs. The contiguous features annotated for Mbp1 are expected to be left intact by a good alignment.

A poor MSA has many errors in its columns; these contain residues that actually have different functions or structural roles, even though they may look similar according to a (pairwise!) scoring matrix. A poor MSA also may have introduced indels in biologically irrelevant positions, to maximize spurious sequence similarities. Some of the features annotated for Mbp1 will be disrupted in a poor alignment and residues that are conserved may be placed into different columns.

Often errors or inconsistencies are easy to spot, and manually editing an MSA is not generally frowned upon, even though this is not a strictly objective procedure. The main goal of manual editing is to make an alignment biologically more plausible. Most comonly this means to mimize the number of rare evolutionary events that the alignment suggests and/or to emphasize conservation of known functional motifs. Here are some examples for what one might aim for in manually editing an alignment:

Reduce number of indels
From a Probcons alignment:
0447_DEBHA    ILKTE-K-T---K--SVVK      ILKTE----KTK---SVVK
9978_GIBZE    MLGLN-PGLKEIT--HSIT      MLGLNPGLKEIT---HSIT
1513_CANAL    ILKTE-K-I---K--NVVK      ILKTE----KIK---NVVK
6132_SCHPO    ELDDI-I-ESGDY--ENVD      ELDDI-IESGDY---ENVD
1244_ASPFU    ----N-PGLREIC--HSIT  ->  ----NPGLREIC---HSIT
0925_USTMA    LVKTC-PALDPHI--TKLK      LVKTCPALDPHI---TKLK
2599_ASPTE    VLDAN-PGLREIS--HSIT      VLDANPGLREIS---HSIT
9773_DEBHA    LLESTPKQYHQHI--KRIR      LLESTPKQYHQHI--KRIR
0918_CANAL    LLESTPKEYQQYI--KRIR      LLESTPKEYQQYI--KRIR

Gaps marked in red were moved. The sequence similarity in the alignment does not change considerably, however the total number of indels in this excerpt is reduced to 13 from the original 22


Move indels to more plausible position
From a CLUSTAL alignment:
4966_CANGL     MKHEKVQ------GGYGRFQ---GTW      MKHEKVQ------GGYGRFQ---GTW
1513_CANAL     KIKNVVK------VGSMNLK---GVW      KIKNVVK------VGSMNLK---GVW
6132_SCHPO     VDSKHP-----------QID---GVW  ->  VDSKHPQ-----------ID---GVW
1244_ASPFU     EICHSIT------GGALAAQ---GYW      EICHSIT------GGALAAQ---GYW

The two characters marked in red were swapped. This does not change the number of indels but places the "Q" into a a column in which it is more highly conserved (green). Progressive alignments are especially prone to this type of error.

Conserve motifs
From a CLUSTAL alignment:
6166_SCHPO      --DKRVA---GLWVPP      --DKRVA--G-LWVPP
XBP1_SACCE      GGYIKIQ---GTWLPM      GGYIKIQ--G-TWLPM
6355_ASPTE      --DEIAG---NVWISP  ->  ---DEIA--GNVWISP
5262_KLULA      GGYIKIQ---GTWLPY      GGYIKIQ--G-TWLPY

The first of the two residues marked in red is a conserved, solvent exposed hydrophobic residue that may mediate domain interactions. The second residue is the conserved glycine in a beta turn that cannot be mutated without structural disruption. Changing the position of a gap and insertion in one sequence improves the conservation of both motifs.


The Ankyrin domains are quite highly diverged, the boundaries not well defined and not even CDD, SMART and SAS agree on the precise annotations. We expect there to be alignment errors in this region. Nevertheless we would hope that a good alignment would recognize homology in that region and that ideally the required indels would be placed between the secondary structure elements, not in their middle. But judging from the sequence alignment alone, we cannot judge where the secondary structure elements ought to be. You should therefore add the following "sequence" to the alignment; it contains exactly as many characters as the Swi6 sequence above and annotates the secondary structure elements. I have derived it from the 1SW6 structure

>SecStruc 1SW6 E: strand   t: turn   H: helix   _: irregular
_EEE__tt___ttt______EE_____t___HHHHHHHHHHHHHHHH_xxxx_HHHHHHH
HHHH_t_____t_____t____HHHHHHH__tHHHHHHHHH____t___tt____HHHHH
HH__HHHH___HHHHHHHHHHHHHEE_t____HHHHHHHHH__t__HHHHHHHHHHHHHH
HHHHHH__EEE_xxxx_HHHHHt_HHHHHHH______t____HHHHHHHH__HHHHHHHH
H____t____t____HHHH___
1SW6_A at the PDBSum database of structure annotations You can compare the diagram there with this text string.


To proceed:

  1. Manually align the Swi6 sequence with yeast Mbp1
  2. Bring the Secondary structure annotation into its correct alignment with Swi6
  3. Bring both CDD ankyrin profiles into the correct alignment with yeast Mbp1

Proceed along the following steps:

Task:

  1. Add the secondary structure annotation to the sequence alignment in Jalview. Copy the annotation, select File → Add sequences → from Textbox and paste the sequence.
  2. Select Help → Documentation and read about Editing Alignments, Cursor Mode and Key strokes.
  3. Click on the yeast Mbp1 sequence row to select the entire row. Then use the cursor key to move that sequence down, so it is directly above the 1SW6 sequence. Select the row of 1SW6 and use shift/mouse to move the sequence elements and edit the alignment to match yeast Mbp1. Refer to the alignment given in the Mbp1 annotation page for the correct alignment.
  4. Align the secondary structure elements with the 1SW6 sequence: Every character of 1SW6 should be matched with either E, t, H, or _. The result should be similar to the Mbp1 annotation page. If you need to insert gaps into all sequences in the alignment, simply drag your mouse over all row headers - movement of sequences is constrained to selected regions, the rest is locked into place to prevent inadvertent misalignments. Remember to save your project from time to time: File → save so you can reload a previous state if anything goes wrong and can't be fixed with Edit → Undo.
  5. Finally align the two CD00204 consensus sequences to their correct positions (again, refer to the Mbp1 annotation page).
  6. You can now consider the principles stated above and see if you can improve the alignment, for example by moving indels out of regions of secondary structure if that is possible without changing the character of the aligned columns significantly. Select blocks within which to work to leave the remaining alignment unchanged. So that this does not become tedious, you can restrict your editing to one Ankyrin repeat that is structurally defined in Swi6. You may want to open the 1SW6 structure in VMD to define the boundaries of one such repeat. You can copy and paste sections from Jalview into your assignment for documentation or export sections of the alignment to HTML (see the example below).

Editing ankyrin domain alignments - Sample

This sample was created by

  1. Editing the alignments as described above;
  2. Copying a block of aligned sequence;
  3. Pasting it To New Alignment;
  4. Colouring the residues by Hydrophobicity and setting the colour saturation according to Conservation;
  5. Choosing File → Export Image → HTML and pasting the resulting HTML source into this Wikipage.


10
|
20
|
30
|
40
|
MBP1_USTMA/341-368   - - Y G D Q L - - - A D - - - - - - - - - - I L - - - - N F Q D D E G E T P L T M A A R A R S
MBP1B_SCHCO/470-498   - R E D G D Y - - - K S - - - - - - - - - - F L - - - - D L Q D E H G D T A L N I A A R V G N
MBP1_ASHGO/465-494   F S P Q Y R I - - - E T - - - - - - - - - - L I - - - - N A Q D C K G S T P L H I A A M N R D
MBP1_CLALU/550-586   G N Q N G N S N D K K E - - - - - - - - - - L I S K F L N H Q D N E G N T A F H I A A Y N M S
MBPA_COPCI/514-542   - H E G G D F - - - R S - - - - - - - - - - L V - - - - D L Q D E H G D T A I N I A A R V G N
MBP1_DEBHA/507-550   I R D S Q E I - - - E N K K L S L S D K K E L I A K F I N H Q D I D G N T A F H I V A Y N L N
MBP1A_SCHCO/388-415   - - Y P K E L - - - A D - - - - - - - - - - V L - - - - N F Q D E D G E T A L T M A A R C R S
MBP1_AJECA/374-403   T L P P H Q I - - - S M - - - - - - - - - - L L - - - - S S Q D S N G D T A A L A A A K N G C
MBP1_PARBR/380-409   I L P P H Q I - - - S L - - - - - - - - - - L L - - - - S S Q D S N G D T A A L A A A K N G C
MBP1_NEOFI/363-392   T C S Q D E I - - - D L - - - - - - - - - - L L - - - - S C Q D S N G D T A A L V A A R N G A
MBP1_ASPNI/365-394   T F S P E E V - - - D L - - - - - - - - - - L L - - - - S C Q D S V G D T A V L V A A R N G V
MBP1_UNCRE/377-406   M Y P H H E V - - - G L - - - - - - - - - - L L - - - - A S Q D S N G D T A A L T A A K N G C
MBP1_PENCH/439-468   T C S Q D E I - - - Q M - - - - - - - - - - L L - - - - S C Q D Q N G D T A V L V A A R N G A
MBPA_TRIVE/407-436   V F P R H E I - - - S L - - - - - - - - - - L L - - - - S S Q D A N G D T A A L T A A K N G C
MBP1_PHANO/400-429   T W I P E E V - - - T R - - - - - - - - - - L L - - - - N A Q D Q N G D T A I M I A A R N G A
MBPA_SCLSC/294-313   - - - - - - - - - - - - - - - - - - - - - - - L - - - - D A R D I N G N T A I H I A A K N K A
MBPA_PYRIS/363-392   T W I P E E V - - - T R - - - - - - - - - - L L - - - - N A A D Q N G D T A I M I A A R N G A
MBP1_/361-390   - - - N H S L G V L S Q - - - - - - - - - - F M - - - - D T Q N N E G D T A L H I L A R S G A
MBP1_ASPFL/328-364   T E Q P G E V I T L G R - - - - - - - - - - F I S E I V N L R D D Q G D T A L N L A G R A R S
MBPA_MAGOR/375-404   Q H D P N F V - - - Q Q - - - - - - - - - - L L - - - - D A Q D N D G N T A V H L A A Q R G S
MBP1_CHAGL/361-390   S R S A D E L - - - Q Q - - - - - - - - - - L L - - - - D S Q D N E G N T A V H L A A M R D A
MBP1_PODAN/372-401   V R Q P E E V - - - Q A - - - - - - - - - - L L - - - - D A Q D E E G N T A L H L A A R V N A
MBP1_LACTH/458-487   F S P R Y R I - - - E N - - - - - - - - - - L I - - - - N A Q D Q N G D T A V H L A A Q N G D
MBP1_FILNE/433-460   - - Y P Q E L - - - A D - - - - - - - - - - V I - - - - N F Q D E E G E T A L T I A A R A R S
MBP1_KLULA/477-506   F T P Q Y R I - - - D V - - - - - - - - - - L I - - - - N Q Q D N D G N S P L H Y A A T N K D
MBP1_SCHST/468-501   A K D P D N K - - - K D - - - - - - - - - - L I A K F I N H Q D S D G N T A F H I C S H N L N
MBP1_SACCE/496-525   F S P Q Y R I - - - E L - - - - - - - - - - L L - - - - N T Q D K N G D T A L H I A S K N G D
CD00204/1-19   - - - - - - - - - - - - - - - - - - - - - - - - - - - - N A R D E D G R T P L H L A A S N G H
CD00204/99-118   - - - - - - - - - - - - - - - - - - - - - - - V - - - - N A R D K D G R T P L H L A A K N G H
1SW6/203-232   L D L K W I I - - - A N - - - - - - - - - - M L - - - - N A Q D S N G D T C L N I A A R L G N
SecStruc/203-232   t _ H H H H H - - - H H - - - - - - - - - - _ _ - - - - _ _ _ _ t _ _ _ _ H H H H H H H H _ _
Aligned sequences before editing. The algorithm has placed gaps into the Swi6 helix LKWIIAN and the four-residue gaps before the block of well aligned sequence on the right are poorly supported.


10
|
20
|
30
|
40
|
MBP1_USTMA/341-368   - - Y G D Q L A D - - - - - - - - - - - - - - I L N F Q D D E G E T P L T M A A R A R S
MBP1B_SCHCO/470-498   - R E D G D Y K S - - - - - - - - - - - - - - F L D L Q D E H G D T A L N I A A R V G N
MBP1_ASHGO/465-494   F S P Q Y R I E T - - - - - - - - - - - - - - L I N A Q D C K G S T P L H I A A M N R D
MBP1_CLALU/550-586   G N Q N G N S N D K K E - - - - - - - L I S K F L N H Q D N E G N T A F H I A A Y N M S
MBPA_COPCI/514-542   - H E G G D F R S - - - - - - - - - - - - - - L V D L Q D E H G D T A I N I A A R V G N
MBP1_DEBHA/507-550   I R D S Q E I E N K K L S L S D K K E L I A K F I N H Q D I D G N T A F H I V A Y N L N
MBP1A_SCHCO/388-415   - - Y P K E L A D - - - - - - - - - - - - - - V L N F Q D E D G E T A L T M A A R C R S
MBP1_AJECA/374-403   T L P P H Q I S M - - - - - - - - - - - - - - L L S S Q D S N G D T A A L A A A K N G C
MBP1_PARBR/380-409   I L P P H Q I S L - - - - - - - - - - - - - - L L S S Q D S N G D T A A L A A A K N G C
MBP1_NEOFI/363-392   T C S Q D E I D L - - - - - - - - - - - - - - L L S C Q D S N G D T A A L V A A R N G A
MBP1_ASPNI/365-394   T F S P E E V D L - - - - - - - - - - - - - - L L S C Q D S V G D T A V L V A A R N G V
MBP1_UNCRE/377-406   M Y P H H E V G L - - - - - - - - - - - - - - L L A S Q D S N G D T A A L T A A K N G C
MBP1_PENCH/439-468   T C S Q D E I Q M - - - - - - - - - - - - - - L L S C Q D Q N G D T A V L V A A R N G A
MBPA_TRIVE/407-436   V F P R H E I S L - - - - - - - - - - - - - - L L S S Q D A N G D T A A L T A A K N G C
MBP1_PHANO/400-429   T W I P E E V T R - - - - - - - - - - - - - - L L N A Q D Q N G D T A I M I A A R N G A
MBPA_SCLSC/294-313   - - - - - - - - - - - - - - - - - - - - - - - - L D A R D I N G N T A I H I A A K N K A
MBPA_PYRIS/363-392   T W I P E E V T R - - - - - - - - - - - - - - L L N A A D Q N G D T A I M I A A R N G A
MBP1_/361-390   N H S L G V L S Q - - - - - - - - - - - - - - F M D T Q N N E G D T A L H I L A R S G A
MBP1_ASPFL/328-364   T E Q P G E V I T L G R F I S E - - - - - - - I V N L R D D Q G D T A L N L A G R A R S
MBPA_MAGOR/375-404   Q H D P N F V Q Q - - - - - - - - - - - - - - L L D A Q D N D G N T A V H L A A Q R G S
MBP1_CHAGL/361-390   S R S A D E L Q Q - - - - - - - - - - - - - - L L D S Q D N E G N T A V H L A A M R D A
MBP1_PODAN/372-401   V R Q P E E V Q A - - - - - - - - - - - - - - L L D A Q D E E G N T A L H L A A R V N A
MBP1_LACTH/458-487   F S P R Y R I E N - - - - - - - - - - - - - - L I N A Q D Q N G D T A V H L A A Q N G D
MBP1_FILNE/433-460   - - Y P Q E L A D - - - - - - - - - - - - - - V I N F Q D E E G E T A L T I A A R A R S
MBP1_KLULA/477-506   F T P Q Y R I D V - - - - - - - - - - - - - - L I N Q Q D N D G N S P L H Y A A T N K D
MBP1_SCHST/468-501   A K D P D N K K D - - - - - - - - - - L I A K F I N H Q D S D G N T A F H I C S H N L N
MBP1_SACCE/496-525   F S P Q Y R I E L - - - - - - - - - - - - - - L L N T Q D K N G D T A L H I A S K N G D
CD00204/1-19   - - - - - - - - - - - - - - - - - - - - - - - - - N A R D E D G R T P L H L A A S N G H
CD00204/99-118   - - - - - - - - - - - - - - - - - - - - - - - - V N A R D K D G R T P L H L A A K N G H
1SW6/203-232   L D L K W I I A N - - - - - - - - - - - - - - M L N A Q D S N G D T C L N I A A R L G N
SecStruc/203-232   t _ H H H H H H H - - - - - - - - - - - - - - _ _ _ _ _ _ t _ _ _ _ H H H H H H H H _ _
Aligned sequence after editing. A significant cleanup of the frayed region is possible. Now there is only one insertion event, and it is placed into the loop that connects two helices of the 1SW6 structure.


Final analysis

Task:

  • Compare the distribution of indels in the ankyrin repeat regions of your alignments.
    • Review whether the indels in this region are concentrated in segments that connect the helices, or if they are more or less evenly distributed along the entire region of similarity.
    • Think about whether the assertion that indels should not be placed in elements of secondary structure has merit in your alignment.
    • Recognize that an indel in an element of secondary structure could be interpreted in a number of different ways:
      • The alignment is correct, the annotation is correct too: the indel is tolerated in that particular case, for example by extending the length of an α-helix or β-strand;
      • The alignment algorithm has made an error, the structural annotation is correct: the indel should be moved a few residues;
      • The alignment is correct, the structural annotation is wrong, this is not a secondary structure element after all;
      • Both the algorithm and the annotation are probably wrong, but we have no data to improve the situation.

(NB: remember that the structural annotations have been made for the yeast protein and might have turned out differently for the other proteins...)

You should be able to analyse discrepancies between annotation and expectation in a structured and systematic way. In particular if you notice indels that have been placed into an annotated region of secondary structure, you should be able to comment on whether the location of the indel has strong support from aligned sequence motifs, or whether the indel could possibly be moved into a different location without much loss in alignment quality.

  • Considering the whole alignment and your experience with editing, you should be able to state whether the position of indels relative to structural features of the ankyrin domains in your organism's Mbp1 protein is reliable. That would be the result of this task, in which you combine multiple sequence and structural information.
  • You can also critically evaluate database information that you have encountered:
  1. Navigate to the CDD annotation for yeast Mbp1.
  2. You can check the precise alignment boundaries of the ankyrin domains by clicking on the (+) icon to the left of the matching domain definition.
  3. Confirm that CDD extends the ankyrin domain annotation beyond the 1SW6 domain boundaries. Given your assessment of conservation in the region beyond the structural annotation: do you think that extending the annotation is reasonable also in YFO's protein? Is there evidence for this in the alignment of the CD00204 consensus with well aligned blocks of sequence beyond the positions that match Swi6?

R code: load alignment and compute information scores

As discussed in the lecture, Shannon information is calculated as the difference between expected and observed entropy, where entropy is the negative sum over probabilities times the log of those probabilities:



Here we compute Shannon information scores for aligned positions of the APSES domain, and plot the values in R. You can try this with any part of your alignment, but I have used only the aligned residues for the APSES domain for my example. This is a good choice for a first try, since there are (almost) no gaps.

Task:

  1. Export only the sequences of the aligned APSES domains to a file on your computer, in FASTA format as explained below. You could call this: Mbp1_All_APSES.fa.
    1. Use your mouse and clik and drag to select the aligned APSES domains in the alignment window.
    2. Copy your selection to the clipboard.
    3. Use the main menu (not the menu of your alignment window) and select File → Input alignment → from Textbox; paste the selection into the textbox and click New Window.
    4. Use File → save as to save the aligned siequences in multi-FASTA format under the filename you want in your R project directory.
  1. Explore the R-code below. Be sure that you understand it correctly. Note that this code does not implement any sampling bias correction, so positions with large numbers of gaps will receive artificially high scores (the alignment looks like the gap charecter were a conserved character).


# CalculateInformation.R
# Calculate Shannon information for positions in a multiple sequence alignment.
# Requires: an MSA in multi FASTA format
 
# It is good practice to set variables you might want to change
# in a header block so you don't need to hunt all over the code
# for strings you need to update.
#
setwd("/your/R/working/directory")
mfa      <- "MBP1_All_APSES.fa"
 
# ================================================
#    Read sequence alignment fasta file
# ================================================
 
# read MFA datafile using seqinr function read.fasta()
library(seqinr)
tmp  <- read.alignment(mfa, format="fasta")
MSA  <- as.matrix(tmp)  # convert the list into a characterwise matrix
                        # with appropriate row and column names using
                        # the seqinr function as.matrix.alignment()
                        # You could have a look under the hood of this
                        # function to understand beter how to convert a
                        # list into something else ... simply type
                        # "as.matrix.alignment" - without the parentheses
                        # to retrieve the function source code (as for any
                        # function btw).

### Explore contents of and access to the matrix of sequences
MSA
MSA[1,]
MSA[,1]
length(MSA[,1])


# ================================================
#    define function to calculate entropy
# ================================================

entropy <- function(v) { # calculate shannon entropy for the aa vector v
	                     # Note: we are not correcting for small sample sizes
	                     # here. Thus if there are a large number of gaps in
	                     # the alignment, this will look like small entropy
	                     # since only a few amino acids are present. In the 
	                     # extreme case: if a position is only present in 
	                     # one sequence, that one amino acid will be treated
	                     # as 100% conserved - zero entropy. Sampling error
	                     # corrections are discussed eg. in Schneider et al.
	                     # (1986) JMB 188:414
	l <- length(v)
	a <- rep(0, 21)      # initialize a vector with 21 elements (20 aa plus gap)
	                     # the set the name of each row to the one letter
	                     # code. Through this, we can access a row by its
	                     # one letter code.
	names(a)  <- unlist(strsplit("acdefghiklmnpqrstvwy-", ""))
	
	for (i in 1:l) {       # for the whole vector of amino acids
		c <- v[i]          # retrieve the character
		a[c] <- a[c] + 1   # increment its count by one
	} # note: we could also have used the table() function for this
	
	tot <- sum(a) - a["-"] # calculate number of observed amino acids
	                       # i.e. subtract gaps
	a <- a/tot             # frequency is observations of one amino acid
	                       # divided by all observations. We assume that
	                       # frequency equals probability.
	a["-"] <- 0       	                        
	for (i in 1:length(a)) {
		if (a[i] != 0) { # if a[i] is not zero, otherwise leave as is.
			             # By definition, 0*log(0) = 0  but R calculates
			             # this in parts and returns NaN for log(0).
			a[i] <- a[i] * (log(a[i])/log(2)) # replace a[i] with
			                                  # p(i) log_2(p(i))
		}
	}
	return(-sum(a)) # return Shannon entropy
}

# ================================================
#    calculate entropy for reference distribution
#    (from UniProt, c.f. Assignment 2)
# ================================================

refData <- c(
    "A"=8.26,
    "Q"=3.93,
    "L"=9.66,
    "S"=6.56,
    "R"=5.53,
    "E"=6.75,
    "K"=5.84,
    "T"=5.34,
    "N"=4.06,
    "G"=7.08,
    "M"=2.42,
    "W"=1.08,
    "D"=5.45,
    "H"=2.27,
    "F"=3.86,
    "Y"=2.92,
    "C"=1.37,
    "I"=5.96,
    "P"=4.70,
    "V"=6.87
    )

### Calculate the entropy of this distribution

H.ref <- 0
for (i in 1:length(refData)) {
	p <- refData[i]/sum(refData) # convert % to probabilities
    H.ref <- H.ref - (p * (log(p)/log(2)))
}

# ================================================
#    calculate information for each position of 
#    multiple sequence alignment
# ================================================

lAli <- dim(MSA)[2] # length of row in matrix is second element of dim(<matrix>).
I <- rep(0, lAli)   # initialize result vector
for (i in 1:lAli) { 
	I[i] = H.ref - entropy(MSA[,i])  # I = H_ref - H_obs
}

### evaluate I
I
quantile(I)
hist(I)
plot(I)

# you can see that we have quite a large number of columns with the same,
# high value ... what are these?

which(I > 4)
MSA[,which(I > 4)]

# And what is in the columns with low values?
MSA[,which(I < 1.5)]


# ===================================================
#    plot the information
#    (c.f. Assignment 5, see there for explanations)
# ===================================================

IP <- (I-min(I))/(max(I) - min(I) + 0.0001)
nCol <- 15
IP <- floor(IP * nCol) + 1
spect <- colorRampPalette(c("#DD0033", "#00BB66", "#3300DD"), bias=0.6)(nCol)
# lets set the information scores from single informations to grey. We   
# change the highest level of the spectrum to grey.
#spect[nCol] <- "#CCCCCC"
Icol <- vector()
for (i in 1:length(I)) {
	Icol[i] <- spect[ IP[i] ] 
}
 
plot(1,1, xlim=c(0, lAli), ylim=c(-0.5, 5) ,
     type="n", bty="n", xlab="position in alignment", ylab="Information (bits)")

# plot as rectangles: height is information and color is coded to information
for (i in 1:lAli) {
   rect(i, 0, i+1, I[i], border=NA, col=Icol[i])
}

# As you can see, some of the columns reach very high values, but they are not
# contiguous in sequence. Are they contiguous in structure? We will find out in
# a later assignment, when we map computed values to structure.


Plot of information vs. sequence position produced by the R script above, for an alignment of Mbp1 ortholog APSES domains.


 

That is all.


 

Links and resources

 


Footnotes and references

  1. The directory also contains sourcecode to generte the PAM matrices. This may be of interest for you if you ever want to produce scoring matrices from your own datasets.
  2. (Taylor et al. (2000) Biochemistry 39: 3943-3954 and Deleeuw et al. (2008) Biochemistry. 47:6378-6385)
  3. The -myceta are well supported groups above the Class rank. See Leotiomyceta for details and references.


 

Ask, if things don't work for you!

If anything about the assignment is not clear to you, please ask on the mailing list. You can be certain that others will have had similar problems. Success comes from joining the conversation.



< Assignment 3 Assignment 5 >